KEGG   Viruses: 3773157
Entry
3773157           CDS       T40000                                 

Gene name
VP3, CSRV_s3gp1
Definition
(RefSeq) Chum salmon reovirus CS; putative NTPase/RNA helicase
Taxonomy
TAX:173082
  Lineage
Viruses; dsRNA viruses; Riboviria; Orthornavirae; Duplornaviricota; Resentoviricetes; Reovirales; Reoviridae; Spinareovirinae; Aquareovirus; Aquareovirus A
Organism
vg  Viruses (Aquareovirus A)
SSDB
Motif
Pfam: zf-C2H2_4 zf-C2H2_11 zf-C2HE zf-C2H2 zf-C2H2_6
Other DBs
NCBI-GeneID: 3773157
NCBI-ProteinID: YP_398631
RS: NC_007584
UniProt: Q8VA41
Position
NC_007584:19..3651
AA seq 1210 aa
MPRTSRNVRATEVATTAIPPSNAATDTTVDTTVAPTIASADAAQHASNISSSQLGPAGVS
DKVPSSVVTNDGDISVTPISENAAQLASSNQPASVIRNPVAAATISIVNPSSLRCQQCGA
KFSSMTQLAEHVRTEHRTGAGSLVTSPAINQAIESWLLTWEDLRLLAPTIATDALNKYMG
EAVAKAPLLIVEDEGLCTSFLASDTISIAGLQREIVGFTWFMETLQMIPALPEGAVNHPI
CHTGWASKDSVSRHLDVRLSPPTHGGCFSIHYRTVEGIRQGHAIQPSYFPCQRPHAGPQV
RSVQSQDQQVYSVDSGPDPRSRGRYVRFFDNKELFAVAYPGREVLMEANRNALFLDESLP
DRVGCIGRAQNVSGDVSAHIDTYELCDDLTLAIREMYHNMLFSMHLDPASVMEIVQDVSQ
QLVAASIPFAQTDTILCPWAASTPTLQLSQVLNLLNVANNTSAALPLIEAAATLIMGITP
LRMEPRILSEAIKRVPETTTIVPSPTGELTRLLKPLGNDYSAIYRCIAGCLYSGLVQMFI
SADAYPDPTQSITSIPAIWKSLIVMLAAPMTTDPHAAVKAFMSMANLLAQPEPIIIPAPG
MTQSTPAVQFSHPEVWPPGFVDPTTLDRNRTPLLHALATMIHAHWPQPGVIQYGRSRLGS
ANLFLPANQLTYPWPTQPLPRITVGPTYDSAMFRWIDSVFGFYINVVNSRYVATIVGDTT
RRTLTGLMAALMQVKTMTPFYIERMCPTEVAVVGGVTVFPPFQVPITRLDPTQVITNVMV
SPRGPPAPCRRSRRSHRYYAYAAPIPCQSIPLRLSLLCCVRQTEATLGPSYHYGSAITPM
FLSEELFTRNQRAVIASEAFVCARSIIAQCVPDGFQVPRPLQDFNQYNASGSTAADLLKA
VDDMFKTAFDIDGSLIEGIGLYGDPRVADLSVAYLRQNGAVERVHTAPDSSFLHEAMQVT
SQVMVNEPNLWAIARGDIILAQNATHNNWDPLNPVGLPIFARGGPNVHVVGSRGMIIPQP
GGLAPMIRDDAGNPQQIEGDWIYPISVLQVSVANFRDHVWPMIQAGRTRVRIEMGHFLYS
IHYHEPFGQITEAPAIDTWLAGISPTGIPPFPLSAPIPQITIPITARRVYFGYCTMNNTG
ATFSTLGAAIQSAWGTDVTIQRNRWPALIDPNYIPGQSQLPARVQLYNPLRRYNYRYPSL
KGMLYIPGVE
NT seq 3633 nt   +upstreamnt  +downstreamnt
atgccacgcacctcgcgcaacgtacgcgccaccgaggttgccactactgccataccacct
agcaatgccgctactgacactaccgttgatactaccgtcgctccaaccatcgctagtgca
gacgccgcccaacatgcatccaacatctcgtcttcacaacttggacccgctggagtttca
gataaggttccttcctccgtcgtgaccaatgatggtgacatttcagtgacccccatctcc
gagaacgccgcgcaactagcatcatccaaccaacccgcgtcagtcatccgtaaccctgtc
gccgctgccaccatttccattgtcaatccctcatccctacgatgccaacaatgcggtgcc
aagttctcgtcgatgacccaactggccgaacacgtgcggaccgagcatcgaactggcgcg
ggctccctggtgacatctcctgcgattaatcaagctatcgaatcttggctgctcacttgg
gaagatcttcgtcttctagcgcctaccatcgccactgacgccttaaacaagtacatggga
gaggctgtagccaaggcaccattattaattgtcgaggatgagggtctttgcacttcattt
cttgcttctgacactatctcaattgctgggctgcaacgagagattgtcggattcacctgg
ttcatggagaccttgcagatgatcccagcgctgcctgagggagccgttaatcatccgatc
tgtcacaccggttgggcgagcaaggattcagtgtcgcgccacttggacgtccgtctttct
cctcccactcatgggggctgtttcagcatacactaccgtactgtcgaagggatacgtcaa
ggacatgcaattcaaccctcatactttccgtgccaacgccctcatgctggtcctcaagtt
cgttctgtccaatctcaagatcaacaagtctactccgtggactcaggaccagacccccga
tcccgtggtcgatacgtccgattctttgacaacaaggagttgtttgctgtcgcctaccct
ggtcgtgaagtgctgatggaggctaaccgcaacgcgcttttcctggatgaatcactcccc
gaccgcgtcggttgtatcggcagggcccagaatgtgtctggtgacgtgagcgcgcacatc
gatacttacgagctgtgcgacgatctaaccctcgccattcgtgaaatgtatcacaatatg
cttttcagcatgcacttggatcctgcatccgtcatggagatcgtgcaagacgtgtctcaa
cagttggtcgccgcatccatccccttcgctcagactgacaccatcctgtgcccatgggct
gcgtccaccccgacccttcaactcagtcaggtcctcaacctactcaacgtggccaacaat
acctcagccgccctcccactcatcgaggccgcagccactctcattatgggcatcacccca
ctccgaatggaaccgcgaatcctgtctgaagccatcaagcgtgtgccggaaacgacgacg
atcgtcccctcacccaccggcgagctcacccgcctcctcaagccgcttggcaatgattac
tcggctatctatcgatgcatcgctggctgtctgtacagtggtcttgtccagatgttcatc
tccgcagatgcttaccctgatcctacccagtccatcacaagtatccctgccatttggaaa
tcccttatcgtcatgctggccgcgcctatgaccactgatcctcacgctgctgtgaaggcg
ttcatgtcgatggccaacctactcgctcagcccgagcccatcatcatccccgcgccgggc
atgacgcagtccactccagccgtacagttcagccaccccgaggtctggcctcctgggttc
gttgatccgaccaccctcgatcgcaatcgcacccccctgctccacgcgctggcgactatg
atccatgcacactggccccaacccggcgtgatccagtatggcaggtcacgtctgggttca
gcgaatctcttcctgcccgccaaccaactcacctacccctggccgactcaacccttacct
cgcatcaccgtcggtcctacctacgactcggccatgttcagatggattgacagcgttttt
ggtttttacatcaacgtagtcaactcccgttacgtggcaaccatcgtcggggataccaca
cgccgcaccttgacgggtttgatggccgcactcatgcaggttaagaccatgacccctttc
tacattgagaggatgtgtccgaccgaggtggccgttgttgggggtgtgaccgtctttcct
ccgttccaagtccctatcactcggttagatcctacccaggtgatcactaacgtgatggta
tccccgcgtggacccccagctccgtgccgacgtagccgtcgatcccatcgttactatgcc
tacgctgcgccaattccctgccagtcgatcccgctgcgattgtcgttgctatgttgtgtg
cgccaaactgaagcgactctcggtccgtcttatcactacggttccgcgatcactcccatg
ttcctgtccgaagaattattcactcgcaaccaaagagcggtgatcgccagcgaggccttc
gtctgcgccaggtctatcatagcccagtgcgtgccagatggattccaagtcccaagacct
ttacaagacttcaatcagtacaatgcttcaggcagcactgcagccgacctcctcaaggcc
gttgacgacatgttcaagactgcttttgacattgatggttcccttatcgagggcattggc
ttgtacggcgatccgcgcgtggccgatctctctgttgcctacctccgtcagaatggcgcg
gtcgagcgtgtccatactgccccagattcctcattcctccacgaagctatgcaggtcacg
tctcaggtcatggtaaacgaacccaatctgtgggccattgctcgtggggacatcattctt
gctcaaaacgccactcacaacaactgggatccactgaaccccgtcggcctacccatcttc
gctcgtgggggtcccaacgtacatgtggttggctcgcgtggcatgatcatcccgcaaccc
ggtggcttggcccccatgattcgagacgacgctggcaatccccagcagatcgagggtgac
tggatctaccccatcagtgtgcttcaggtgtcagtagctaatttcagggaccatgtctgg
ccgatgattcaagctggacggacgcgtgtccgtattgagatgggccacttcctgtactcc
attcactaccatgagcctttcggtcagattactgaagctcccgcgattgacacctggctc
gctggcatctccccaactggcatcccacctttcccattgagtgccccaattccccaaatc
accatcccgatcaccgcccgccgtgtgtacttcggatactgcaccatgaacaacaccggt
gccacgttttccactctcggtgcagccattcagtcggcttggggaactgacgtcaccatc
cagcgaaatcgatggccggccctcatcgaccccaactacatccctggccagtcccaactt
cccgctcgtgtccagctttacaatccactgcgccgctataactatcgttacccatctctg
aagggcatgctgtacatccccggtgttgagtag

DBGET integrated database retrieval system