KEGG   Viruses: 3783762
Entry
3783762           CDS       T40000                                 

Gene name
EBNA-3A, HHV4_EBNA-3A
Definition
(RefSeq) Human gammaherpesvirus 4; nuclear antigen EBNA-3A
  KO
K21855  EBV nuclear antigen 3
Taxonomy
TAX:10376 [GN:T40079]
  Lineage
Viruses; dsDNA viruses; Herpesvirales; Herpesviridae; Gammaherpesvirinae; Lymphocryptovirus
Organism
vg  Viruses (Human gammaherpesvirus 4)
SSDB
Motif
Pfam: EBV-NA3
Other DBs
NCBI-GeneID: 3783762
NCBI-ProteinID: YP_401669
RS: NC_007605
UniProt: P12977 A0A0B6VPX8
Position
NC_007605:join(79955..80293,80382..82877)
AA seq 944 aa
MDKDRPGPPALDDNMEEEVPSTSVVQEQVSAGDWENVLIELSDSSSEKEAEDAHLEPAQK
GTKRKRVDHDAGGSAPARPMLPPQPDLPGREAILRRFPLDLRTLLQAIGAAATRIDTRAI
DQFFGSQISNTEMYIMYAMAIRQAIRDRRRNPASRRDQAKWRLQTLAAGWPMGYQAYSSW
MYSYTDHQTTPTFVHLQATLGCTGGRRCHVTFSAGTFKLPRCTPGDRQWLYVQSSVGNIV
QSCNPRYSIFFDYMAIHRSLTKIWEEVLTPDQRVSFMEFLGFLQRTDLSYIKSFVSDALG
TTSIQTPWIDDNPSTETAQAWNAGFLRGRAYGIDLLRTEGEHVEGATGETREESEDTESD
GDDEDLPCIVSRGGPKVKRPPIFIRRLHRLLLMRAGKRTEQGKEVLEKARGSTYGTPRPP
VPKPRPEVPQSDETATSHGSAQVPEPPTIHLAAQGMAYPLHEQHGMAPCPVAQAPPTPLP
PVSPGDQLPGVFSDGRVACAPVPAPAGPIVRPWEPSLTQAAGQAFAPVRPQHMPVEPVPV
PTVALERPVYPKPVRPAPPKIAMQGPGETSGIRRARERWRPAPWTPNPPRSPSQMSVRDR
LARLRAEAQVKQASVEVQPPQLTQVSPQQPMEGPLVPEQQMFPGAPFSQVADVVRAPGVP
AMQPQYFDLPLIQPISQGAPVAPLRASMGPVPPVPATQPQYFDIPLTEPINQGASAAHFL
PQQPMEGPLVPEQWMFPGAALSQSVRPGVAQSQYFDLPLTQPINHGAPAAHFLHQPPMEG
PWVPEQWMFQGAPPSQGTDVVQHQLDALGYTLHGLNHPGVPVSPAVNQYHLSQAAFGLPI
DEDESGEGSDTSEPCEALDLSIHGRPCPQAPEWPVQEEGGQDATEVLDLSIHGRPRPRTP
EWPVQGEGGQNVTGPETRRVVVSAVVHMCQDDEFPDLQDPPDEA
NT seq 2835 nt   +upstreamnt  +downstreamnt
atggacaaggacaggccgggtcccccggccctggatgacaacatggaagaagaagtccca
tctacctcggttgtgcaggaacaggtatcggcgggagattgggaaaatgtcctcatagag
ttatcagatagcagctcagaaaaggaagcagaagatgcccacctggagccggcccagaag
ggtacgaagagaaagcgggtcgatcatgatgccggtgggtcagctccagcacgacccatg
ctcccaccccagccggatctccctgggcgagaagccattctccgcaggtttccactagat
ctaagaacacttcttcaagcgattggagccgcggctacgcgcatcgacacacgagccata
gaccagtttttcggatcccagatttcaaataccgagatgtacataatgtatgccatggcc
attcgacaggccattagagatcgtcggagaaatccagcttctcgtagagatcaggccaaa
tggagactgcaaaccctggccgccggatggcctatgggttaccaggcatacagcagctgg
atgtacagctacaccgatcaccagacgactcccacattcgtacatctccaggcgacactt
gggtgcacaggtggccgtaggtgtcacgtgaccttttccgccggcacctttaagctgccg
cgatgtacccccggggatcgccagtggttgtatgttcagagctccgtgggtaacattgta
cagagctgtaatccccgctacagtattttctttgactatatggctatacacaggagcctc
acgaaaatctgggaggaagttttaacacctgaccagcgtgtttcatttatggaattccta
ggatttttgcagagaacggatttgtcctatatcaagagctttgtcagcgatgccctgggc
accactagtatccaaacaccgtggatcgatgacaatcctagcacggagacggcacaggct
tggaatgccggctttctccggggtcgtgcgtatgggatagacttgcttagaactgaaggg
gaacatgtcgaaggtgctaccggtgaaacgcgagaagaaagtgaggacacggagagcgat
ggagatgatgaagatcttccttgtatagtgtccagaggtggacctaaggtcaaacgaccc
cctatatttataagacgtctgcacaggttgctgctgatgagagcgggcaaacgaacagaa
cagggcaaggaggtactggaaaaggcccgtgggagcacttatggcacacctaggccgcct
gttccgaaaccaagaccagaggtcccacaaagcgacgagacagctaccagtcacgggtcg
gcgcaagtcccagaacccccaaccattcacctagcagctcagggaatggcatacccatta
catgaacaacacggcatggccccgtgtccggtagcacaggccccacctacgcccttgccc
cctgtatctccaggggatcaactcccaggtgtttttagcgacgggcgagtggcgtgtgca
ccagtacccgccccggctgggcctattgtccggccctgggagccatccctgacacaggct
gcggggcaggcctttgcacccgttagaccacaacacatgccagtagaacccgtccctgtc
ccgacagtggcacttgagcgaccagtttaccccaagccagttcgtccggcacctcctaag
attgctatgcagggccccggggaaacttctggcattagacgcgcgcgggagcgttggagg
cccgcaccttggacgccaaatccaccccgttctcccagtcagatgtccgtgcgtgaccgt
ctggctcgtttgcgtgctgaggcacaggtcaaacaggctagtgttgaggtgcagcccccc
cagttgacccaagtatcccctcagcaaccaatggaggggccgttggtaccagagcagcag
atgttccctggtgccccctttagccaggttgctgatgtggtccgggcacctggggtaccg
gcgatgcagccacagtactttgacctccccttaattcaacccattagccagggggcaccc
gtggccccgttgagggctagtatgggcccggtacctccggtaccggcaacacagccacag
tattttgacatccccttaactgaacccattaaccagggggcatccgcggcccattttctc
cctcagcaaccgatggaggggccgttggtacctgagcagtggatgttcccaggtgccgcc
ctgagccagagtgttaggccaggggtagcgcagtcacaatattttgacctccccttaact
caacccattaaccatggggcacccgcagcccatttcctccatcagccaccaatggagggg
ccgtgggtacccgagcagtggatgttccaaggtgccccccctagccaaggcactgacgtg
gtccaacatcagctggatgctttggggtatacactccatggtcttaaccatcccggggtt
cccgtgtctcctgccgttaaccaatatcatctcagccaggctgcctttgggttacctatt
gatgaggatgagagtggcgaggggtccgatacctccgagccgtgtgaagctcttgatttg
tcaatccatggcaggccctgccctcaggcccccgagtggcctgttcaagaggagggtggc
caggatgccaccgaggttcttgatttgtcaatccatggcaggccccgccctcggaccccc
gagtggcctgttcaaggggaaggtggccaaaatgtcacaggccctgaaactagaagggtg
gtggtgtcagctgttgttcacatgtgtcaggatgacgagtttccggatctacaagatcct
ccagatgaggcctaa

DBGET integrated database retrieval system