KEGG   Viruses: 3896424
Entry
3896424           CDS       T40000                                 

Gene name
PB1-F2, FLUAVH5N1_s2gp2
Definition
(RefSeq) Influenza A virus (A/goose/Guangdong/1/1996(H5N1)); PB1-F2 protein
  KO
K19397  Influenza A virus protein PB1-F2
Taxonomy
TAX:93838 [GN:T40041]
  Lineage
Viruses; -ssRNA viruses; Riboviria; Orthornavirae; Negarnaviricota; Polyploviricotina; Insthoviricetes; Articulavirales; Orthomyxoviridae; Alphainfluenzavirus; Influenza A virus; H5N1 subtype
Organism
vg  Viruses (Influenza A virus)
SSDB
Motif
Pfam: PB1-F2
Other DBs
NCBI-GeneID: 3896424
NCBI-ProteinID: YP_473348
RS: NC_007358
UniProt: P0C791
Position
NC_007358:119..391
AA seq 90 aa
MEQEQDTPWTQSTEHINIQKRGNGQRTQRLEHPNSIRLMDHYLRIMSRVGMHKQIVYWKQ
WLSLKNPTQGSLKTRVLKRWKLFSKQEWIS
NT seq 273 nt   +upstreamnt  +downstreamnt
atggaacaggaacaggatacaccatggacacagtcaacagaacacatcaatattcagaaa
aggggaaatggacaacgaacacagagactggagcaccccaactcaatccgattgatggac
cactacctgaggataatgagccgagtgggtatgcacaaacagattgtgtattggaagcaa
tggctttccttgaagaatcccacccagggatctttgaaaactcgtgtcttgaaacgatgg
aagttgttcagcaaacaagagtggataagctga

DBGET integrated database retrieval system