KEGG   Viruses: 4238558
Entry
4238558           CDS       T40000                                 

Gene name
TATV_DAH68_091
Definition
(RefSeq) Taterapox virus; IMV membrane protein
Taxonomy
TAX:28871
  Lineage
Viruses; dsDNA viruses; Poxviridae; Chordopoxvirinae; Orthopoxvirus
Organism
vg  Viruses (Taterapox virus)
SSDB
Motif
Pfam: L1R_F9L COMMD1_N T_hemolysin LTXXQ
Other DBs
NCBI-GeneID: 4238558
NCBI-ProteinID: YP_717398
RS: NC_008291
UniProt: Q0NPC0
Position
NC_008291:76880..77632
AA seq 250 aa
MGAAASIQTTVNTLSERISSKLEQEANASAQTKCDIEIGNFYIRQNHGCNLTVKNMCSAD
ADAQLDAVLSAATETYSGLTPEQKAYVPAMFTAALNIQTSVNTVVRDFENYVKQTCNSSA
VVDNKLKIQNVIIDECYGAPGSPTNLEFINTGSSKGNCAIKALMQLTTKATTQIAPRQVA
GTGVQFYMIVIGVIILAALFMYYAKRMLFTSTNDKIKLILANKENVHWTTYMDTFFRTSP
MVIATTDMQN
NT seq 753 nt   +upstreamnt  +downstreamnt
atgggtgccgcggcaagcatacagacgacggtgaatacactcagcgaacgtatctcgtct
aaattagaacaagaagcgaatgctagtgctcaaacaaaatgtgatatagaaatcggaaat
ttttatatccgacaaaaccatggatgtaacctcactgttaaaaatatgtgctccgcggat
gcggatgctcagttggatgctgtgttatcagccgctacagaaacatatagtggattaaca
ccggaacaaaaagcatacgtaccagctatgtttactgctgcgttaaacattcagacgagt
gtaaacactgttgttagagattttgaaaattatgtgaaacagacttgtaattctagcgcg
gtcgtcgataacaaattaaagatacaaaacgtaattatagatgaatgttacggagcccca
ggatctccaacaaatttggaatttattaatacaggatctagcaaaggaaattgtgccatt
aaggcgttgatgcaattgacgactaaggccactactcaaatagcacctagacaagttgct
ggtacaggagttcagttttatatgattgttatcggtgttataatattggcagcgttgttt
atgtactatgccaagcgtatgctgttcacgtccaccaatgataaaatcaaacttatttta
gccaataaggaaaacgtccattggactacttacatggacacattctttagaacttctcca
atggttattgctaccacggatatgcaaaactga

DBGET integrated database retrieval system