KEGG   Viruses: 4238561
Entry
4238561           CDS       T40000                                 

Gene name
TATV_DAH68_094
Definition
(RefSeq) Taterapox virus; DNA-binding virion core protein
Taxonomy
TAX:28871
  Lineage
Viruses; dsDNA viruses; Poxviridae; Chordopoxvirinae; Orthopoxvirus
Organism
vg  Viruses (Taterapox virus)
SSDB
Motif
Pfam: Pox_VP8_L4R
Other DBs
NCBI-GeneID: 4238561
NCBI-ProteinID: YP_717401
RS: NC_008291
UniProt: Q0NPB7
Position
NC_008291:78968..79723
AA seq 251 aa
MSLLLENLIEEDTIFFAGSISEYDDLQMVIAGAKSKFPRSMLSIFNIVPRTMSKYELELI
HNENITGAMFTTMYNIRNNLGLGDDKLTIEAIENYFLDPNNEVMPLIINNTDMTAVIPKK
SGRRKNKNMVIFRQGSSPILCIFETRKKINIYKENMESASTEYTPIGDNKALISKYAGIN
VLNVYSPSTSMRLNAIYGFTNKNKLEKLSTNKELESYSSSPLQEPIRLNDFLGLLECVKK
NIPLTDIPTKD
NT seq 756 nt   +upstreamnt  +downstreamnt
atgagtctactgctagaaaacctcatcgaagaagataccatattttttgcaggaagtata
tctgagtatgatgatttacaaatggttattgccggagcaaaatccaaatttccaagatct
atgctttctatttttaatatagtacctagaacgatgtcaaaatatgagttggagttgatt
cataacgagaatatcacaggggcaatgtttaccacaatgtataatataagaaacaatttg
ggtttaggcgatgataaactaactattgaagccattgaaaactatttcttggatcctaac
aatgaggttatgcctcttattattaataatacggatatgactgccgtcattcctaaaaaa
agtggtaggagaaagaataagaacatggttatcttccgtcaaggatcatcacctatcttg
tgtattttcgaaactcgtaaaaagattaatatttataaagaaaatatggaatccgcgtcg
actgagtatacacctatcggagacaacaaggctttgatatctaaatatgcgggaattaat
gtcctgaatgtgtattctccttccacatccatgagattgaatgccatttacggattcacc
aataaaaataaactagagaaacttagtactaataaggaactagaatcgtatagttctagc
cctcttcaagaacccattaggttaaatgattttctgggactattggaatgtgttaaaaag
aatattcctctaacagatattccgacaaaggattga

DBGET integrated database retrieval system