KEGG   Viruses: 4238741
Entry
4238741           CDS       T40000                                 

Gene name
TATV_DAH68_074
Definition
(RefSeq) Taterapox virus; IMV membrane protein
Taxonomy
TAX:28871
  Lineage
Viruses; dsDNA viruses; Poxviridae; Chordopoxvirinae; Orthopoxvirus
Organism
vg  Viruses (Taterapox virus)
SSDB
Motif
Pfam: Pox_EPC_I2-L1 CoV_S2 vMSA DUF3671 DUF2207 ATG27 zf-LITAF-like DUF5542
Other DBs
NCBI-GeneID: 4238741
NCBI-ProteinID: YP_717381
RS: NC_008291
UniProt: Q0NPD7
Position
NC_008291:complement(60666..60887)
AA seq 73 aa
MDKLYAAIFGVFMGSPEDDLTDFIEIVKSVLSDEKTVTSTNNTGCWGWYWLIIIFFIVLI
LLLLIYLYLKVVW
NT seq 222 nt   +upstreamnt  +downstreamnt
atggataagttgtacgccgctatatttggtgtatttatgggttctccggaagatgatttg
acagactttatagaaattgttaaatctgttctaagtgatgagaaaactgtcacatcaact
aataataccggttgttggggttggtattggttaattattattttttttatagttcttatt
ctactactattgatatatttgtatttaaaagttgtttggtga

DBGET integrated database retrieval system