KEGG   Viruses: 43740569
Entry
43740569          CDS       T40000                                 
Symbol
ORF3a, GU280_gp03
Name
(RefSeq) Severe acute respiratory syndrome coronavirus 2; ORF3a protein
  KO
K24579  SARS coronavirus accessory protein 3a
Virus
2697049  Severe acute respiratory syndrome coronavirus 2
SSDB
Motif
Pfam: bCoV_viroporin
Other DBs
NCBI-GeneID: 43740569
NCBI-ProteinID: YP_009724391
RS: NC_045512
UniProt: P0DTC3
Structure
Position
NC_045512:25393..26220
AA seq 275 aa
MDLFMRIFTIGTVTLKQGEIKDATPSDFVRATATIPIQASLPFGWLIVGVALLAVFQSAS
KIITLKKRWQLALSKGVHFVCNLLLLFVTVYSHLLLVAAGLEAPFLYLYALVYFLQSINF
VRIIMRLWLCWKCRSKNPLLYDANYFLCWHTNCYDYCIPYNSVTSSIVITSGDGTTSPIS
EHDYQIGGYTEKWESGVKDCVVLHSYFTSDYYQLYSTQLSTDTGVEHVTFFIYNKIVDEP
EEHVQIHTIDGSSGVVNPVMEPIYDEPTTTTSVPL
NT seq 828 nt   +upstreamnt  +downstreamnt
atggatttgtttatgagaatcttcacaattggaactgtaactttgaagcaaggtgaaatc
aaggatgctactccttcagattttgttcgcgctactgcaacgataccgatacaagcctca
ctccctttcggatggcttattgttggcgttgcacttcttgctgtttttcagagcgcttcc
aaaatcataaccctcaaaaagagatggcaactagcactctccaagggtgttcactttgtt
tgcaacttgctgttgttgtttgtaacagtttactcacaccttttgctcgttgctgctggc
cttgaagccccttttctctatctttatgctttagtctacttcttgcagagtataaacttt
gtaagaataataatgaggctttggctttgctggaaatgccgttccaaaaacccattactt
tatgatgccaactattttctttgctggcatactaattgttacgactattgtataccttac
aatagtgtaacttcttcaattgtcattacttcaggtgatggcacaacaagtcctatttct
gaacatgactaccagattggtggttatactgaaaaatgggaatctggagtaaaagactgt
gttgtattacacagttacttcacttcagactattaccagctgtactcaactcaattgagt
acagacactggtgttgaacatgttaccttcttcatctacaataaaattgttgatgagcct
gaagaacatgtccaaattcacacaatcgacggttcatccggagttgttaatccagtaatg
gaaccaatttatgatgaaccgacgacgactactagcgtgcctttgtaa

DBGET integrated database retrieval system