KEGG   Viruses: 4961494
Entry
4961494           CDS       T40000                                 

Gene name
HHV8GK18_gp80
Definition
(RefSeq) Human gammaherpesvirus 8; K13
  KO
K21662  KSHV FLICE inhibitory protein
Taxonomy
TAX:37296 [GN:T40081]
  Lineage
Viruses; dsDNA viruses; Duplodnaviria; Heunggongvirae; Peploviricota; Herviviricetes; Herpesvirales; Herpesviridae; Gammaherpesvirinae; Rhadinovirus
Organism
vg  Viruses (Human gammaherpesvirus 8)
SSDB
Motif
Pfam: DED
Other DBs
NCBI-GeneID: 4961494
NCBI-ProteinID: YP_001129429
RS: NC_009333
UniProt: F5HEZ4 Q76RF1
Structure
PDB: 
3CL3

Position
NC_009333:complement(122393..122959)
AA seq 188 aa
MATYEVLCEVARKLGTDDREVVLFLLNVFIPQPTLAQLIGALRALKEEGRLTFPLLAECL
FRAGRRDLLRDLLHLDPRFLERHLAGTMSYFSPYQLTVLHVDGELCARDIRSLIFLSKDT
IGSRSTPQTFLHWVYCMENLDLLGPTDVDALMSMLRSLSRVDLQRQVQTLMGLHLSGPSH
SQHYRHTP
NT seq 567 nt   +upstreamnt  +downstreamnt
atggccacttacgaggttctctgtgaggtggcgcggaaactgggcacggatgacagggaa
gtggtattgttcctcctaaacgtgttcatacctcaacccacactggcccaattaattgga
gctcttagagctttaaaggaggagggcaggttaacgtttcccctgttagcggaatgtctg
tttcgtgcaggtcgcagagacctcttgcgcgacctgcttcacttagacccgcgtttttta
gagcgccacctagcgggcacaatgagttatttcagcccttatcagctcactgttctccac
gtagacggggagctgtgtgcgagggatattaggtctttgatatttttaagcaaggacact
atagggtctcgcagcacaccacagacattcttacactgggtgtactgtatggaaaactta
gacctactgggtcccactgacgtggatgccctaatgtcaatgcttagatctttgtcaaga
gtagacctacagcgccaagtgcaaaccctaatgggccttcacctttccggcccatcacac
tcccaacactatcgccatacaccatag

DBGET integrated database retrieval system