KEGG   Viruses: 4961527Help
Entry
4961527           CDS       T40000                                 

Gene name
HHV8GK18_gp81
Definition
(RefSeq) Human gammaherpesvirus 8; LANA
  KO
K21664  KSHV latency-associated nuclear antigen
Taxonomy
TAX:37296 [GN:T40081]
  Lineage
Viruses; dsDNA viruses; Herpesvirales; Herpesviridae; Gammaherpesvirinae; Rhadinovirus
Taxonomy
Organism
vg  Viruses (Human gammaherpesvirus 8)
SSDB OrthologParalogGFIT
Other DBs
NCBI-GeneID: 4961527
NCBI-ProteinID: YP_001129431
RS: NC_009333
UniProt: Q9QR71
Structure
PDB: 

Position
NC_009333:complement(124057..127446)
AA seq 1129 aa AA seqDB search
MAPPGMRLRSGRSTGAPLTRGSCRKRNRSPERCDLGDDLHLQPRRKHVADSVDGRECGPH
TLPIPGSPTVFTSGLPAFVSSPTLPVAPIPSPAPATPLPPPALLPPVTTSSSPIPPSHPV
SPGTTDTHSPSPALPPTQSPESSQRPPLSSPTGRPDSSTPMRPPPSQQTTPPHSPTTPPP
EPPSKSSPDSLAPSTLRSLRKRRLSSPQGPSTLNPICQSPPVSPPRCDFANRSVYPPWAT
ESPIYVGSSSDGDTPPRQPPTSPISIGSSSPSEGSWGDDTAMLVLLAEIAEEASKNEKEC
SENNQAGEDNGDNEISKESQVDKDDNDNKDDEEEQETDEEDEEDDEEDDEEDDEEDDEED
DEEDDEEDDEEEDEEEDEEEDEEEDEEEEEDEEDDDDEDNEDEEDDEEEDKKEDEEDGGD
GNKTLSIQSSQQQQEPQQQEPQQQEPQQQEPQQQEPQQQEPQQQEPQQQEPQQREPQQRE
PQQREPQQREPQQREPQQREPQQREPQQREPQQREPQQREPQQREPQQREPQQQEPQQQE
PQQQEPQQQEPQQQEPQQQEPQQQEPQQQEPQQQEPQQQEPQQQEPQQQEPQQQDEQQQD
EQQQDEQQQDEQQQDEQQQDEQQQDEQQQDEQEQQDEQQQDEQQQQDEQEQQEEQEQQEE
QQQDEQQQDEQQQDEQQQDEQEQQDEQQQDEQQQQDEQEQQEEQEQQEEQEQQEEQEQQE
EQEQELEEQEQELEEQEQELEEQEQELEEQEQELEEQEQELEEQEQELEEQEQELEEQEQ
ELEEQEQELEEQEQELEEQEQELEEQEQELEEQEQELEEQEQEQELEEVEEQEQEQEEQE
LEEVEEQEQEQEEQEEQELEEVEEQEEQELEEVEEQEEQELEEVEEQEQQGVEQQEQETV
EEPIILHGSSSEDEMEVDYPVVSTHEQIASSPPGDNTPDDDPQPGPSREYRYVLRTSPPH
RPGVRMRRVPVTHPKKPHPRYQQPPVPYRQIDDCPAKARPQHIFYRRFLGKDGRRDPKCQ
WKFAVIFWGNDPYGLKKLSQAFQFGGVKAGPVSCLPHPGPDQSPITYCVYVYCQNKDTSK
KVQMARLAWEASHPLAGNLQSSIVKFKKPLPLTQPGENQGPGDSPQEMT
NT seq 3390 nt NT seq  +upstreamnt  +downstreamnt
atggcgcccccgggaatgcgcctgaggtcgggacggagcaccggcgcgcccttaacgaga
ggaagttgtaggaaacgaaacaggtctccggaaagatgtgaccttggcgatgacctacat
ctacaaccgcgaaggaagcatgtcgccgactccgtcgacggccgggaatgtggaccccac
accttgcctataccaggaagtcccacagtgttcacatccgggctgccagcatttgtgtct
agtcctactttaccggtggctcccattccttcacccgctcccgcaacacctttacctcca
ccggcactcttaccccccgtaaccacgtcttcctccccaatccctccatcccatcctgtg
tctccggggaccacggatactcattctccatctcctgcattgccacccacgcagtctcca
gagtcttctcaaaggccaccgctttcaagtcctacaggaaggccagactcttcaacacct
atgcgtccgccaccctcgcagcagactacacctccacactcacccacgactcctccaccc
gagcctccctccaagtcgtcaccagactctttagctccgtctaccctgcgtagcctgaga
aaaagaaggctatcgtccccccaaggtccctctacactaaacccaatatgtcagtcgccc
ccagtctctccccctagatgtgacttcgccaaccgtagtgtgtaccccccatgggccaca
gagtccccgatctacgtgggatcatccagcgatggcgatactccgccacgccaaccgcct
acatctcccatctccataggatcatcatccccgtctgagggatcctggggtgatgacaca
gccatgttggtgctccttgcggagattgcagaagaagcatccaagaatgaaaaagaatgt
tccgaaaataatcaggctggcgaggataatggggacaacgagattagcaaggaaagtcag
gttgacaaggatgacaatgacaataaggatgatgaggaggagcaggagacagatgaggag
gacgaggaggatgacgaggaggatgacgaggaggatgacgaggaggatgacgaggaggat
gacgaggaggatgacgaggaggatgacgaggaggaggacgaggaggaggacgaggaggag
gacgaggaggaggacgaggaggaggaggaggacgaggaggatgacgatgatgaggacaat
gaggacgaggaggatgacgaggaggaggacaagaaggaggacgaggaggacgggggcgat
ggaaacaaaacgttgagcatccaaagttcacaacagcagcaggagccacaacagcaggag
ccacagcagcaggagccacaacagcaggagccacagcagcaggagccacagcagcaggag
ccacaacagcaggagccacagcagcaggagccacaacagcgggagccacagcagcgggag
ccacagcagcgggagccccagcagcgggagccccagcagcgggagccccagcagcgggag
ccccagcagcgggagccccagcagcgggagccacagcagcgggagccacagcagcgggag
ccacagcagcgggagccccagcagcgggagccacagcagcaggagccacagcagcaggag
ccacagcagcaggagccacagcagcaggagccacagcagcaggagccacagcagcaggag
ccacagcagcaggagccacaacagcaggagccacaacagcaggagccacaacagcaggag
ccacaacagcaggagccacaacagcaggagccacagcagcaggatgagcagcagcaggat
gagcagcagcaggatgagcagcagcaggatgagcagcagcaggatgagcagcagcaggat
gagcagcagcaggatgagcagcagcaggatgagcaggagcagcaggatgagcagcagcag
gatgagcagcagcagcaggatgaacaggagcagcaggaggagcaggagcagcaggaggag
cagcagcaggatgagcagcagcaggatgagcagcagcaggatgagcagcagcaggatgag
caggagcagcaggatgagcagcagcaggatgagcagcagcagcaggatgaacaggagcag
caggaggagcaggagcagcaggaggagcaggagcagcaggaggagcaggagcagcaggag
gagcaggagcaggagttagaggagcaggagcaggagttagaggagcaggagcaggagtta
gaggagcaggagcaggagttagaggagcaggagcaggagttagaggagcaggagcaggag
ttagaggagcaggagcaggagttagaggagcaggagcaggagttagaggagcaggagcag
gagttagaggagcaggagcaggagttagaggagcaggagcaggagttagaggagcaggag
caggagttagaggagcaggagcaggagttagaggagcaggagcaggagttagaggagcag
gagcaggagcaggagttagaggaggtggaagagcaagagcaggagcaggaagagcaggaa
ttagaggaggtggaggagcaagagcaggagcaggaggagcaggaggagcaggagttagag
gaggtggaagagcaggaagagcaggagttagaggaggtggaagagcaggaagagcaggag
ttagaggaggtggaagagcaggagcagcagggggtggaacagcaggagcaggagacggtg
gaagagcccataatcttgcacgggtcgtcatccgaggacgaaatggaagtggattaccct
gttgttagcacacatgaacaaattgccagtagcccaccaggagataatacaccagacgat
gacccacaacctggcccatctcgcgaataccgctatgtactcagaacatcaccaccccac
agacctggagttcgtatgaggcgcgttccagttacccacccaaaaaagccacatccaaga
taccaacaaccaccggtcccttacagacagatagatgattgtcctgcgaaagctaggcca
caacacatcttttatagacgctttttgggaaaggatggaagacgagatccaaagtgtcaa
tggaagtttgcagtgattttttggggcaatgacccatacggacttaaaaaattatctcag
gccttccagtttggaggagtaaaggcaggccccgtgtcctgcttgccccaccctggacca
gaccagtcgcccataacttattgtgtatatgtgtattgtcagaacaaagacacaagtaag
aaagtacaaatggcccgcctagcctgggaagctagtcaccccctggcaggaaacctacaa
tcttccatagttaagtttaaaaagcccctgccattaacccagccaggggaaaaccaaggt
cctggggactctccacaggaaatgacataa

DBGET integrated database retrieval system