KEGG   Viruses: 5075727Help
Entry
5075727           CDS       T40000                                 

Gene name
flavivirus_polyprotein_gene, DV3_gp1
Definition
(RefSeq) Dengue virus 3; flavivirus polyprotein
Taxonomy
TAX:11069
  Lineage
Viruses; ssRNA viruses; ssRNA positive-strand viruses, no DNA stage; Flaviviridae; Flavivirus; unclassified Crinivirus
Taxonomy
Organism
vg  Viruses (Dengue virus)
SSDB OrthologParalogGFIT
Motif
Pfam: Flavi_NS5 Flavi_NS1 Flavi_glycoprot Flavi_NS4B Flavi_DEAD Flavi_NS4A Flavi_NS2B Peptidase_S7 Flavi_propep Flavi_glycop_C Flavi_M Flavi_NS2A Flavi_capsid FtsJ DEAD Helicase_C Trypsin_2 Peptidase_S29 AAA_30 AAA_19 ResIII Peptidase_S32
Motif
Other DBs
NCBI-GeneID: 5075727
NCBI-ProteinID: YP_001621843
RS: NC_001475
UniProt: Q6YMS4
Structure
PDB: 

Position
NC_001475:95..10267
AA seq 3390 aa AA seqDB search
MNNQRKKTGKPSINMLKRVRNRVSTGSQLAKRFSKGLLNGQGPMKLVMAFIAFLRFLAIP
PTAGVLARWGTFKKSGAIKVLKGFKKEISNMLSIINQRKKTSLCLMMILPAALAFHLTSR
DGEPRMIVGKNERGKSLLFKTASGINMCTLIAMDLGEMCDDTVTYKCPHITEVEPEDIDC
WCNLTSTWVTYGTCNQAGEHRRDKRSVALAPHVGMGLDTRTQTWMSAEGAWRQVEKVETW
ALRHPGFTILALFLAHYIGTSLTQKVVIFILLMLVTPSMTMRCVGVGNRDFVEGLSGATW
VDVVLEHGGCVTTMAKNKPTLDIELQKTEATQLATLRKLCIEGKITNITTDSRCPTQGEA
VLPEEQDQNYVCKHTYVDRGWGNGCGLFGKGSLVTCAKFQCLEPIEGKVVQYENLKYTVI
ITVHTGDQHQVGNETQGVTAEITPQASTTEAILPEYGTLGLECSPRTGLDFNEMILLTMK
NKAWMVHRQWFFDLPLPWASGATTETPTWNRKELLVTFKNAHAKKQEVVVLGSQEGAMHT
ALTGATEIQNSGGTSIFAGHLKCRLKMDKLELKGMSYAMCTNTFVLKKEVSETQHGTILI
KVEYKGEDAPCKIPFSTEDGQGKAHNGRLITANPVVTKKEEPVNIEAEPPFGESNIVIGI
GDNALKINWYKKGSSIGKMFEATERGARRMAILGDTAWDFGSVGGVLNSLGKMVHQIFGS
AYTALFSGVSWVMKIGIGVLLTWIGLNSKNTSMSFSCIAIGIITLYLGAVVQADMGCVIN
WKGKELKCGSGIFVTNEVHTWTEQYKFQADSPKRLATAIAGAWENGVCGIRSTTRMENLL
WKQIANELNYILWENNIKLTVVVGDTLGVLEQGKRTLTPQPMELKYSWKTWGKAKIVTAE
TQNSSFIIDGPNTPECPSASRAWNVWEVEDYGFGVFTTNIWLKLREVYTQLCDHRLMSAA
VKDERAVHADMGYWIESQKNGSWKLEKASLIEVKTCTWPKSHTLWTNGVLESDMIIPKSL
AGPISQHNYRPGYHTQTAGPWHLGKLELDFNYCEGTTVVITESCGTRGPSLRTTTVSGKL
IHEWCCRSCTLPPLRYMGEDGCWYGMEIRPISEKEENMVKSLVSAGSGKVDNFTMGVLCL
AILFEEVLRGKFGKKHMIAGVFFTFVLLLSGQITWRDMAHTLIMIGSNASDRMGMGVTYL
ALIATFKIQPFLALGFFLRKLTSRENLLLGVGLAMATTLQLPEDIEQMANGVALGLMALK
LITQFETYQLWTALVSLTCSNTIFTLTVAWRTATLILAGVSLLPVCQSSSMRKTDWLPMT
VAAMGVPPLPLFIFSLKDTLKRRSWPLNEGVMAVGLVSILASSLLRNDVPMAGPLVAGGL
LIACYVITGTSADLTVEKAPDVTWEEEAEQTGVSHNLMITVDDDGTMRIKDDETENILTV
LLKTALLIVSGIFPYSIPATLLVWHTWQKQTQRSGVLWDVPSPPETQKAELEEGVYRIKQ
QGIFGKTQVGVGVQKEGVFHTMWHVTRGAVLTHNGKRLEPNWASVKKDLISYGGGWRLSA
QWQKGEEVQVIAVEPGKNPKNFQTTPGTFQTTTGEIGAIALDFKPGTSGSPIINREGKVV
GLYGNGVVTKNGGYVSGIAQTNAEPDGPTPELEEEMFKKRNLTIMDLHPGSGKTRKYLPA
IVREAIKRRLRTLILAPTRVVAAEMEEALKGLPIRYQTTATKSEHTGREIVDLMCHATFT
MRLLSPVRVPNYNLIIMDEAHFTDPASIAARGYISTRVGMGEAAAIFMTATPPGTADAFP
QSNAPIQDEERDIPERSWNSGNEWITDFAGKTVWFVPSIKAGNDIANCLRKNGKKVIQLS
RKTFDTEYQKTKLNDWDFVVTTDISEMGANFKADRVIDPRRCLKPVILTDGPERVILAGP
MPVTAASAAQRRGRVGRNPQKENDQYIFTGQPLNNDEDHAHWTEAKMLLDNINTPEGIIP
ALFEPEREKSAAIDGEYRLKGESRKTFVELMRRGDLPVWLAHKVASEGIKYTDRKWCFDG
QRNNQILEENMDVEIWTKEGEKKKLRPRWLDARTYSDPLALKEFKDFAAGRKSIALDLVT
EIGRVPSHLAHRTRNALDNLVMLHTSEDGGRAYRHAVEELPETMETLLLLGLMILLTGGA
MLFLISGKGIGKTSIGLICVIASSGMLWMAEVPLQWIASAIVLEFFMMVLLIPEPEKQRT
PQDNQLAYVVIGILTLAATIAANEMGLLETTKRDLGMSKEPGVVSPTSYLDVDLHPASAW
TLYAVATTVITPMLRHTIENSTANVSLAAIANQAVVLMGLDKGWPISKMDLGVPLLALGC
YSQVNPLTLTAAVLLLITHYAIIGPGLQAKATREAQKRTAAGIMKNPTVDGIMTIDLDSV
IFDSKFEKQLGQVMLLVLCAVQLLLMRTSWALCEALTLATGPITTLWEGSPGKFWNTTIA
VSMANIFRGSYLAGAGLAFSIMKSVGTGKRGTGSQGETLGEKWKKKLNQLSRKEFDLYKK
SGITEVDRTEAKEGLKRGETTHHAVSRGSAKLQWFVERNMVVPEGRVIDLGCGRGGWSYY
CAGLKKVTEVRGYTKGGPGHEEPVPMSTYGWNIVKLMSGKDVFYLPPEKCDTLLCDIGES
SPSPTVEESRTIRVLKMVEPWLKNNQFCIKVLNPYMPTVIEHLERLQRKHGGMLVRNPLS
RNSTHEMYWISNGTGNIVSSVNMVSRLLLNRFTMTHRRPTIEKDVDLGAGTRHVNAEPET
PNMDVIGERIKRIKEEHNSTWHYDDENPYKTWAYHGSYEVKATGSASSMINGVVKLLTKP
WDVVPMVTQMAMTDTTPFGQQRVFKEKVDTRTPRPMPGTRKAMEITAEWLWRTLGRNKRP
RLCTREEFTKKVRTNAAMGAVFTEENQWDSAKAAVEDEEFWKLVDRERELHKLGKCGSCV
YNMMGKREKKLGEFGKAKGSRAIWYMWLGARYLEFEALGFLNEDHWFSRENSYSGVEGEG
LHKLGYILRDISKIPGGAMYADDTAGWDTRITEDDLHNEEKIIQQMDPEHRQLANAIFKL
TYQNKVVKVQRPTPTGTVMDIISRKDQRGSGQLGTYGLNTFTNMEAQLVRQMEGEGVLTK
ADLENPHLLEKKITQWLETKGVERLKRMAISGDDCVVKPIDDRFANALLALNDMGKVRKD
IPQWQPSKGWHDWQQVPFCSHHFHELIMKDGRKLVVPCRPQDELIGRARISQGAGWSLRE
TACLGKAYAQMWSLMYFHRRDLRLASNAICSAVPVHWVPTSRTTWSIHAHHQWMTTEDML
TVWNRVWIEENPWMEDKTPVTTWENVPYLGKREDQWCGSLIGLTSRATWAQNIPTAIQQV
RSLIGNEEFLDYMPSMKRFRKEEESEGAIW
NT seq 10173 nt NT seq  +upstreamnt  +downstreamnt
atgaacaaccaacggaagaagacgggaaaaccgtctatcaatatgctgaaacgcgtgaga
aaccgtgtgtcaactggatcacagttggcgaagagattctcaaaaggactgctgaacggc
cagggaccaatgaaattggttatggcgttcatagctttcctcagatttctagccattcca
ccaacagcaggagtcttggctagatggggaaccttcaagaagtcgggggccattaaggtc
ctgaaaggcttcaagaaggagatctcaaacatgctgagcataatcaaccaacggaaaaag
acatcgctctgtctcatgatgatattgccagcagcacttgctttccacttgacttcacga
gatggagagccgcgcatgattgtggggaagaatgaaagaggtaaatccctactttttaag
acagcctctggaatcaacatgtgcacactcatagccatggatttgggagagatgtgtgat
gacacggtcacttacaaatgcccccacattaccgaagtggaacctgaagacattgactgc
tggtgcaaccttacatcaacatgggtgacttatggaacgtgcaatcaagctggagagcat
agacgcgacaagagatcagtggcgttagctccccatgtcggcatgggactggacacacgc
acccaaacctggatgtcggctgaaggagcttggagacaagtcgagaaggtagagacatgg
gcccttaggcacccagggttcaccatactagccctatttctcgcccattacataggcact
tccctgacccagaaggtggttattttcatattattaatgctggtcaccccatccatgaca
atgagatgtgtgggagtaggaaacagagattttgtggaagggctatcaggagctacgtgg
gttgacgtggtgctcgagcacggggggtgtgtgactaccatggctaagaacaagcccacg
ctggatatagagcttcagaagaccgaggccacccaactggcgaccctaaggaagctatgc
attgaggggaaaattaccaacataacaactgactcaagatgtcctacccaaggggaagcg
gttttgcctgaggagcaggaccagaactacgtgtgtaagcatacatacgtagacagaggt
tgggggaacggttgtggtttgtttggcaaaggaagcttggtaacatgtgcgaaatttcaa
tgcctggaaccaatagagggaaaagtggtgcaatatgagaacctcaaatacaccgtcatc
attacagtgcacacaggagaccaacaccaggtgggaaatgaaacgcaaggagtcacggct
gagataacacctcaggcatcaaccactgaagccatcttgcctgaatatggaacccttggg
ctagaatgctcaccacggacaggtttggatttcaatgaaatgatcttactaacaatgaag
aacaaagcatggatggtacatagacaatggttctttgacctacctctaccatgggcatca
ggagctacaacagaaacaccaacctggaacaggaaggagcttcttgtgacattcaaaaac
gcacatgcgaaaaaacaagaagtagttgtccttggatcgcaagagggagcaatgcatacc
gcactgacaggagctacagaaatccaaaactcaggaggcacaagcattttcgcggggcac
ttaaaatgtagacttaagatggacaaattggaactcaaggggatgagctatgcaatgtgc
acgaatacctttgtgttgaagaaagaagtctcagaaacgcagcacgggacaatactcatt
aaggttgagtacaaaggggaagatgcaccttgcaagattcccttttccacagaggatgga
caagggaaagctcataatggcagactgatcacagccaaccctgtggtgactaagaaggag
gagcctgtcaatattgaggctgaacctccttttggggaaagcaatatagtaattggaatt
ggagacaacgccttgaaaatcaactggtacaagaaggggagctcgattgggaagatgttc
gaggccactgaaaggggtgcaaggcgcatggccatcttgggagacacagcttgggacttt
ggatcagtgggtggtgttctgaactcattaggcaaaatggtgcaccaaatatttggaagt
gcttatacagccctgttcagtggagtctcttgggtgatgaaaattggaataggtgtcctc
ttgacttggatagggttgaattcaaaaaacacatccatgtcattttcatgcattgcgata
ggaatcattacactctatctgggagctgtggtacaagctgacatggggtgtgtcataaac
tggaagggcaaagaactcaaatgtggaagcggaattttcgtcaccaatgaggtccatacc
tggacagagcaatacaaattccaagcagactccccaaaaagattggcaacagccattgca
ggcgcctgggagaatggagtgtgtggaattaggtcaacaaccagaatggagaatctcttg
tggaagcaaatagccaatgaactgaactacatattatgggaaaacaatatcaaattaacg
gtagttgtgggcgatacacttggggtcttagagcaagggaaaagaacactaacaccacaa
cccatggagctaaaatactcatggaaaacgtggggaaaggcaaaaatagtgacagctgaa
acacaaaattcctctttcataatagacgggccaaacacaccggagtgtccaagtgcctca
agagcatggaatgtgtgggaggtggaagattacgggttcggagtcttcacaaccaacata
tggctgaaactccgagaggtctacacccaactatgtgaccataggctaatgtcggcagct
gtcaaggatgagagggccgtgcatgccgacatgggctactggatagaaagccaaaagaat
ggaagttggaagctagaaaaagcatccctcatagaggtaaaaacctgcacatggccaaaa
tcacacactctctggactaatggtgtgctagagagtgacatgatcatcccaaagagtcta
gctggtcctatctcacaacacaactacaggcccgggtaccacacccaaacggcaggaccc
tggcacttaggaaaattggagctggacttcaactactgtgaaggaacaacagttgtcatc
acagaaagctgtgggacaagaggcccatcattgagaacaacaacagtgtcagggaagttg
atacacgaatggtgttgccgctcgtgcacacttccccccctgcgatacatgggagaagac
ggctgctggtatggcatggaaatcagacccatcagtgagaaagaagagaacatggtaaag
tctttagtctcagcgggaagtggaaaggtggacaacttcacaatgggtgtcttgtgtttg
gcaatcctctttgaagaggtgttgagaggaaaatttgggaagaaacacatgattgcaggg
gttttctttacgtttgtgctccttctctcagggcaaataacatggagagacatggcgcac
acactaataatgatcgggtccaacgcctctgacaggatgggaatgggcgtcacctaccta
gctctaattgcaacatttaaaatccagccattcttggctttgggatttttcctaagaaag
ctgacatctagagaaaatttattgttaggagttgggttggccatggcaacaacgttacaa
ctgccagaggacattgaacaaatggcaaatggagtcgctctggggctcatggctcttaaa
ctgataacacaatttgaaacataccaattgtggacggcattagtctccttaacgtgttca
aacacaatttttacgttgactgttgcctggagaacagccactctgattttggccggagtt
tcgcttttaccagtgtgccagtcttcaagcatgaggaaaacagattggctcccaatgaca
gtggcagctatgggagttccaccccttccactttttatttttagcttgaaagacacactc
aaaaggagaagctggccactgaatgaaggggtgatggctgttgggcttgtgagcattctg
gccagttctctccttagaaatgatgtgcccatggctggaccattagtggccgggggcttg
ctgatagcgtgctacgtcataactggcacgtcagcggacctcactgtagaaaaagcccca
gatgtaacatgggaggaagaggctgagcagacaggagtgtcccacaacttaatgatcaca
gttgatgatgatggaacaatgagaataaaagatgatgagactgagaacatcctaacagtg
cttttaaaaacagcattactaatagtatcaggcatttttccatactccatacccgcaaca
ttgttggtctggcacacttggcaaaaacaaacccaaagatccggcgttttatgggacgta
cccagccccccagagacacagaaagcagaactggaagaaggggtttataggatcaaacag
caaggaatttttgggaaaacccaagtaggggttggagtacagaaagaaggagtcttccac
accatgtggcacgtcacaagaggggcagtgttgacacataatgggaaaagactggaacca
aactgggctagtgtgaaaaaagatctgatttcatatggaggaggatggagactgagcgca
caatggcaaaagggggaggaggtgcaggttattgccgtagagccagggaagaacccaaag
aactttcaaaccacgccaggcactttccagactactacaggggaaataggagcaattgca
ctggatttcaagcctggaacttcaggatctcctatcataaatagagagggaaaggtagtg
ggactgtatggcaatggagtggttacaaagaatggtggctatgtcagcggaatagcgcaa
acaaatgcagaaccagatggaccgacaccagagttggaagaagagatgttcaaaaagcga
aacctgaccataatggatcttcatcctgggtcaggaaagacacggaaataccttccagct
attgtcagagaggcaatcaagagacgtttaagaaccttaattttggcaccgacaagggtg
gttgcagctgagatggaagaagcattgaaagggctcccaataaggtaccaaacaacagca
acaaaatctgaacacacaggaagagagattgttgatctaatgtgccacgcaacgttcaca
atgcgtttgctgtcaccagttagggttccaaattacaacttgataataatggatgaggcc
catttcacagacccagccagtatagcggctagagggtacatatcaactcgtgttggaatg
ggagaggcagccgcaatcttcatgacagcaacaccccctggaacagctgatgcctttcct
cagagcaacgctccaattcaagatgaagaaagggacataccagaacgctcatggaattca
ggcaatgaatggattaccgacttcgctgggaaaacggtgtggtttgtccctagcattaaa
gccggaaatgacatagcaaactgcttgcgaaaaaacgggaaaaaagtcattcaacttagt
aggaagacttttgacacagaatatcagaagactaaactgaatgattgggactttgtggtg
acaactgacatttcagaaatgggggccaatttcaaagcagatagagtgatcgacccaaga
agatgtctcaaaccagtgatcttgacagatggaccagagcgggtgatcctggccggacca
atgccagtcaccgcggcgagtgctgcgcaaaggagagggagagttggcaggaacccacaa
aaagagaatgaccagtacatattcacgggccagcctctcaacaatgatgaagaccatgct
cactggacagaagcaaaaatgctgctggacaacatcaacacaccagaagggattatacca
gctctctttgaaccagaaagggagaagtcagccgccatagacggtgagtatcgcctgaag
ggtgagtccaggaagactttcgtggaactcatgaggaggggtgaccttccagtttggtta
gcccataaagtagcatcagaaggaatcaaatacacagatagaaaatggtgctttgatggg
caacgcaataatcaaattttagaggagaacatggatgtggaaatttggacaaaggaagga
gaaaagaaaaaattgagacctaggtggcttgatgcccgcacttattcagatccattggca
ctcaaggaattcaaggactttgcggctggcagaaagtcaatcgcccttgatcttgtgaca
gaaataggaagagtgccttcacatctagcccacagaacaagaaacgctctggacaatctg
gtgatgctgcatacgtcagaagatggcggtagggcttacaggcatgcggtggaggaacta
ccagaaacaatggaaacactcctactcttgggactaatgatcttgttgacaggtggagca
atgcttttcttgatatcaggtaaagggattggaaagacttcaataggactcatttgtgta
atcgcttccagcggcatgttgtggatggccgaagttccactccaatggatcgcgtcggct
atagtcctggagttttttatgatggtgttgctcataccagaaccagaaaagcagagaacc
ccccaagacaaccaactcgcatatgtcgtgataggcatacttacattggctgcaacaata
gcagccaatgaaatgggactgctggaaaccacaaagagagacttaggaatgtctaaggag
ccaggtgttgtttctccaaccagctatttggatgtggacttgcacccagcatcagcctgg
acattgtacgccgtggccactacagtaataacaccaatgttaagacataccatagagaat
tctacagcaaatgtgtccctggcagctatagccaaccaggcagtggtcctgatgggtttg
gacaaaggatggccaatatcaaaaatggacttaggcgtgccactactggcactgggttgc
tattcacaagtgaacccactgactctaactgcggcagtacttttgctaatcacacattat
gctatcataggtccaggattgcaagcaaaagccacccgtgaagctcagaaaaggacagct
gctggaataatgaagaatccaacagtggatgggataatgacaatagacctagattctgta
atatttgattcaaaatttgaaaaacaactgggacaggttatgctcctggttttgtgcgca
gtccaactcttgctaatgagaacatcatgggccttgtgtgaagctttaactctagctaca
ggaccaataacaacactctgggaaggatcacctggtaagttctggaacaccacgatagct
gtttccatggcgaacatttttagagggagctatttagcaggagctgggcttgctttttct
attatgaaatcagttggaacaggaaaaagaggaacaggctcacaaggtgaaactttagga
gaaaaatggaaaaagaaattaaatcaattatcccggaaagagtttgacctttacaagaaa
tctggaatcactgaagtggatagaacagaagccaaagaagggttgaaaagaggagagaca
acacatcatgccgtgtcccgaggtagcgcaaaacttcaatggtttgtggaaagaaacatg
gtcgttcccgaaggaagagtcatagacttgggctgtggaagaggaggctggtcatattac
tgtgcaggactgaaaaaagtcacagaagtgcgaggatacacaaaaggcggtccaggacac
gaagaaccagtacctatgtctacatatggatggaacatagttaagttaatgagcggaaag
gatgtgttctatctcccacctgaaaagtgtgataccctgttgtgtgacattggagaatct
tcaccaagcccaacagtggaagagagcagaactataagagttttgaagatggttgaacca
tggctaaaaaacaaccagttttgcattaaagttttgaacccttacatgccaactgtgatt
gagcacctagaaagactacaaaggaaacatggaggaatgcttgtgagaaatccactttca
cgaaactccacgcacgaaatgtactggatatctaatggcacaggtaacattgtctcttca
gtcaacatggtgtctagattgctactgaacaggttcacgatgacacacaggagacccacc
atagagaaagatgtggatttaggagcaggaactcgacatgttaatgcggaaccagaaaca
cccaacatggatgtcattggggaaagaataaaaaggatcaaggaggagcataattcaaca
tggcactatgatgacgaaaacccctacaaaacgtgggcttaccatggatcctatgaagtc
aaagccacaggctcagcctcctccatgataaatggagtcgtgaaactcctcaccaaacca
tgggatgtggtgcccatggtgacacagatggcaatgacagacacaactccatttggccag
cagagagtctttaaagagaaagtggacaccaggacgcccaggcccatgccagggacaaga
aaggctatggagatcacagcggagtggctctggagaaccctgggaaggaacaaaagaccc
agattatgcacaagggaagagtttacaaaaaaggtcagaactaacgcagccatgggcgcc
gttttcacagaggagaaccaatgggacagtgcgaaagctgctgttgaggatgaagaattt
tggaaacttgtggacagagaacgtgaactccacaaattgggcaaatgtggaagctgcgtt
tataacatgatgggcaagagagagaaaaaacttggagagtttggcaaagcaaaaggcagt
agagctatatggtacatgtggttgggagccaggtaccttgagttcgaagcccttggattc
ttaaatgaagaccactggttctcgcgtgaaaactcttacagtggagtagaaggagaagga
ctgcacaagctaggctacatattaagggacatttccaagatacccggaggagccatgtat
gctgatgacacagctggttgggacacaagaataacagaagatgacctgcacaatgaggaa
aagatcatacagcaaatggaccctgaacacaggcagttagcgaacgctatattcaagctc
acataccaaaacaaagtggtcaaagttcaacgaccgactccaacgggcacggtaatggat
attatatctaggaaagaccaaaggggcagtggacaactgggaacttatggcctgaataca
ttcaccaacatggaagcccagttagtcagacaaatggaaggagaaggtgtgctgacaaag
gcagacctcgagaaccctcatctgctagagaagaaaatcacacaatggttggaaaccaaa
ggagtggagaggttaaaaagaatggccattagcggggatgattgcgtggtgaaaccaatc
gatgacaggttcgctaatgccctgcttgctttgaacgatatgggaaaggttcggaaagac
atacctcaatggcagccatcaaagggatggcatgattggcaacaggttcctttctgctcc
caccactttcatgaattgatcatgaaagatggaagaaagttggtggttccctgcagaccc
caggacgaactaataggaagagcaagaatctctcaaggagcgggatggagccttagagaa
actgcatgtctggggaaagcctacgcccaaatgtggagtctcatgtattttcacagaaga
gatctcagattagcatccaacgccatatgttcagcagtaccagtccactgggttcccaca
agtagaacgacatggtctattcatgctcaccatcagtggatgactacagaagacatgctt
actgtttggaacagggtgtggatagaggaaaatccatggatggaagacaaaactccagtt
acaacttgggaaaatgttccatatctaggaaagagagaagaccaatggtgtggatcactt
attggtctcacttccagagcaacctgggcccagaacatacccacagcaattcaacaggtg
agaagccttataggcaatgaagagttcctggactacatgccttcaatgaagagattcagg
aaggaagaggagtcggagggagccatttggtaa

DBGET integrated database retrieval system