KEGG   Viruses: 5176146Help
Entry
5176146           CDS       T40000                                 

Gene name
WMSV_gp2
Definition
(RefSeq) Woolly monkey sarcoma virus; hypothetical protein
Taxonomy
TAX:11970
  Lineage
Viruses; ssRNA-RT viruses; Ortervirales; Retroviridae; Orthoretrovirinae; Gammaretrovirus
Taxonomy
Organism
vg  Viruses (Woolly monkey sarcoma virus)
SSDB OrthologParalogGFIT
Motif
Pfam: MLVIN_C rve rve_3 SH3_11
Motif
Other DBs
NCBI-GeneID: 5176146
NCBI-ProteinID: YP_001165470
RS: NC_009424
UniProt: P03359
Position
NC_009424:<2891..3775
AA seq 294 aa AA seqDB search
GSLGRGDRPGVYWEVDFTEVKPGRYGNRYLLVFIDTFSGWVEAFPTKTETALTVCKRNST
PLRIPKVLGSDNGPAFVAQVSQGLATQLGINWKLHCAYRPQSSGQVERMNRTIKETLTKL
ALETGGKDWVALLPLALLRAKNTPSRFGLTPYEILYGGPPPILESGGTLGPDDNFLPVLF
THLKALEVVRTQIWDQIKEVYKPGTVAIPHPFQVGDQVLVRRHRPGSLEPRWKGPYLVLL
TTPTAVKVDGIAAWVHASHLKPAPPSAPDESWELEKADHPLKLRIRRRRNESAK
NT seq 885 nt NT seq  +upstreamnt  +downstreamnt
gggtcactgggacgaggagatcgccccggcgtgtactgggaggtagacttcacagaagtg
aagcctggccggtatggaaacaggtatctgctggtattcatagatactttttccggatgg
gtagaagcttttcctaccaaaactgaaacggccctgaccgtctgcaagagaaattctacc
ccgcttcggatccctaaggtactcgggtcagacaatggcccagcctttgttgctcaggta
agtcagggactggccactcaactggggataaattggaagttacattgtgcgtatagaccc
cagagctcaggtcaggtagagagaatgaacaggacaatcaaggagaccttgaccaaatta
gccttagagaccggtggaaaagactgggtggccctccttcccttagcgctgctcagagcc
aagaatacccctagccggtttggtctaactccttatgaaattctctatgggggaccgccc
cccatacttgagtctggagggacattgggtcccgatgataattttctccctgtcttattt
actcatttaaaggctttagaagttgtgaggacccagatctgggaccagatcaaggaggtg
tacaagcccggtaccgtggcaatcccccacccgttccaggtcggggaccaagtgcttgtc
agacgccatcgacccggcagccttgagcctcggtggaaaggcccgtacctggtgttgctg
accaccccgaccgcggtaaaagtcgacggtatcgctgcctgggtccatgcttctcacctc
aagcctgcaccaccctcggcaccagatgagtcctgggagctggaaaaagctgatcatcct
cttaagctgcgtattcggcggcggcggaacgagtctgcaaaataa

DBGET integrated database retrieval system