KEGG   Viruses: 5176170Help
Entry
5176170           CDS       T40000                                 

Gene name
HHV4tp2_gp31
Definition
(RefSeq) Human herpesvirus 4 type 2; BZLF2
Taxonomy
TAX:12509
  Lineage
Viruses; dsDNA viruses; Herpesvirales; Herpesviridae; Gammaherpesvirinae; Lymphocryptovirus; NC_043061  Equid herpesvirus 7 strain T-07 DNA polymerase gene
Taxonomy
Organism
vg  Viruses (Human gammaherpesvirus 4)
SSDB OrthologParalogGFIT
Motif
Pfam: Lectin_C
Motif
Other DBs
NCBI-GeneID: 5176170
NCBI-ProteinID: YP_001129466
RS: NC_009334
UniProt: Q1HVG2
Position
NC_009334:complement(89959..90630)
AA seq 223 aa AA seqDB search
MVSFKQVRVPLFTAIALVIVLLLAYFLPPRVRGGGRVSAAAITWVPKPNVEVWPVDPPPP
VNFNKTAEQEYGDKEIKLPHWTPTLHTFQVPKNYTKANCTYCNTREYTFSYKERCFYFTK
KKHTWNGCFQACAELYPCTYFYGPTPDILPVVTRNLNAIESLWVGVYRVGEGNWTSLDGG
TFKVYQIFGSHCTYVSKFSTVPVSHHECSFLKPCLCVSQRSNS
NT seq 672 nt NT seq  +upstreamnt  +downstreamnt
atggtttcgtttaagcaggtgagggtgccattgtttaccgccatcgcacttgttattgtt
ctactcctggcatactttttgccacccagggtaagaggaggagggcgggtgtcggcagcg
gccatcacctgggtacccaaaccaaatgtagaggtctggccggtggatcctccaccgccg
gttaactttaacaagacggccgagcaggagtatggggacaaagagataaaactgccacat
tggacacccaccctgcacacgtttcaggtacccaaaaactataccaaagctaactgtaca
tactgcaacacaagagaatacacattttcatataaagaacgctgtttttatttcaccaaa
aagaagcacacctggaatgggtgtttccaagcctgtgcagagctatatccatgcacttat
ttttatgggccaacgcccgatattctacctgtggtaactagaaatctgaatgccattgag
tccctttgggtcggggtgtacagggtgggagaagggaactggacatcattagatgggggg
acttttaaggtttatcaaatttttggctctcattgtacatatgtcagcaaatttagtaca
gttccagtctcacaccatgagtgttcattccttaaaccatgtttatgtgtcagtcaaaga
tcaaatagctaa

DBGET integrated database retrieval system