KEGG   Viruses: 5176259Help
Entry
5176259           CDS       T40000                                 

Gene name
LSNPV_gpp145
Definition
(RefSeq) Leucania separata nucleopolyhedrovirus; egt
Taxonomy
  Lineage
Viruses; dsDNA viruses; Baculoviridae; Alphabaculovirus
Taxonomy
Organism
vg  Viruses (Leucania separata nucleopolyhedrovirus)
SSDB OrthologParalogGFIT
Motif
Pfam: UDPGT Glyco_tran_28_C
Motif
Other DBs
NCBI-GeneID: 5176259
NCBI-ProteinID: YP_758442
RS: NC_008348
UniProt: Q0IKX4
Position
NC_008348:complement(141656..143320)
AA seq 554 aa AA seqDB search
MSLMNKFSYDPHIKLSARRELGHRSVRFLHAPHPLEQFVMFRFVVFVAAIASVRSARILC
MFPTPAYSHQMVFRSYTQALIERGHTLTVITPTPLNAKNSANLTEIDISNSHTHYKQLVD
QSKLYKKRGIIADVESVNHRNYLGLVRMVSEQFRNERVGELLRADRDTNRFDLIVTEAFI
DFPLILSHFYDAPVIQMSSGHGLAENFETMGAVSRHPIYYPNVWRDTFPSSSNVWQMANE
LYRELVLYREFALLADEEDKMLKRQFGRHVPGVRALRNNVQMLLLNTHAMFDNNRPVSPS
VQYLGGIHLKKQSNIMNSHLSQFLDDSTMGVVYVSFGSGVHALDMDDEFLHVFLSTFRSL
PYNILWKADSVNDTLLPGNVLVQKWFPQQDVLNHRNVRVFVTHGGIQSTDEAIDAQVPLV
GLPLMGDQFFNVAKFQELGIGRALNAHTVDAAELIEAILDANENPAYKRNLARVKRIILD
QPMKPLEKAVWYTEHVIRHGGAAHLKTRASNVAWYEYLMVNALVPVVVSAFIGCFGTYSK
YTLGLSHIYYYAIF
NT seq 1665 nt NT seq  +upstreamnt  +downstreamnt
atgtcattgatgaataaattttcgtacgacccacatataaaattgtcagctcggcgcgaa
ttaggtcacagatccgttcgattcttacacgcgccgcaccctctcgaacagtttgtcatg
ttccggttcgtcgtgttcgtcgcggcgatcgcgtcggttcggagcgcacgcatcttgtgc
atgttcccgacgcccgcctacagccatcagatggtgttccgctcgtacacgcaggctctg
atcgaacggggccacacgctgaccgtcatcacgccgacgcctttaaacgctaaaaactcg
gccaaccttaccgagatcgacatcagcaactcgcacacgcactacaagcaactggtggac
cagtcgaagttgtacaagaagcgcggcataatagccgacgtcgagagcgtcaaccatcgc
aactacctgggactcgtgcgcatggtcagcgaacagtttcgaaacgaacgggtcggcgaa
ttgctgcgcgcggatcgcgacacgaaccggttcgatctgatcgtgaccgaggcgttcatc
gattttccattgatcctgtcgcacttctacgacgcgcccgtcatacaaatgtcgtcgggc
cacggcctggcggagaatttcgaaacgatgggcgccgtgagtcgccatcccatctactat
cccaacgtgtggcgcgacacctttccctcgagctcgaacgtctggcaaatggcgaacgaa
ctgtacagagaactggtgctctatcgagagttcgccctgctcgccgacgaggaggacaag
atgctgaagcgccagttcggcagacacgttcccggcgtacgagcgctacggaacaacgtg
caaatgctcttgctcaacacgcacgccatgttcgacaacaaccgaccggtttcgccgagc
gtccaatacctgggcggaatacacttgaaaaaacagtcgaacattatgaattcgcatctc
tcgcagtttctagacgattccacgatgggcgtcgtttacgtcagtttcggctcgggcgtg
cacgcgctcgacatggacgacgagttcctgcacgtgttcttatcgacgttccggtcgttg
ccctacaacattttgtggaaggccgatagtgtcaacgatacgctgctgccgggcaatgtg
ctcgtgcaaaagtggtttccgcaacaggacgtgctgaaccatcgcaacgtgagggtcttt
gtcacgcacggcggcattcaatcgacggacgaggcgatagacgctcaggtcccgctcgtg
ggactgcctctgatgggcgatcagtttttcaacgtggccaaatttcaggagctaggcata
gggcgcgcgctcaacgcgcacaccgtcgacgcagccgaactgatcgaggccatcctcgac
gccaacgagaatcccgcgtacaaacgaaacctggcccgagttaaacgcatcatactcgac
cagcccatgaaaccgctcgagaaggccgtctggtacaccgaacacgtgataagacacggc
ggcgctgcccatctaaagaccagggcctccaatgtcgcctggtacgagtatttgatggtc
aatgcgctcgtgcccgtggtcgtgtccgcattcatcggctgttttggcacctactcaaaa
tacacgttgggcctctctcacatctattattatgccatattctaa

DBGET integrated database retrieval system