KEGG   Viruses: 6218885Help
Entry
6218885           CDS       T40000                                 

Gene name
LaP1706_gp02
Definition
(RefSeq) Lactococcus phage 1706; hypothetical protein
Taxonomy
TAX:475178
  Lineage
Viruses; dsDNA viruses; Caudovirales; Siphoviridae; unclassified Siphoviridae
Taxonomy
Organism
vg  Viruses (Lactococcus phage 1706)
SSDB OrthologParalogGFIT
Motif
Pfam: HALZ DivIC MAD MbeD_MobD UPF0242 ZapB Nnf1 COX16 FliD_N YabA
Motif
Other DBs
NCBI-GeneID: 6218885
NCBI-ProteinID: YP_001828650
RS: NC_010576
UniProt: B2BTG6
Position
NC_010576:652..963
AA seq 103 aa AA seqDB search
MENWASAIIGAIVAGFTFLTAIATLATKRNDSSSRMTNKSFDIISKRLDIAEAKVSSLES
VQSDYMILKDDYDDLKEKYSALKLENTRLSERVKELEIKEGKN
NT seq 312 nt NT seq  +upstreamnt  +downstreamnt
atggagaattgggctagtgccattattggcgctattgttgctggttttacttttctaaca
gccattgctacattggctacaaaacgtaatgactctagttcaaggatgactaataaatct
tttgatattatttcaaagagattagacattgctgaagctaaagtctccagcttagaaagt
gtacaatcagattatatgattcttaaagatgactatgatgaccttaaggaaaagtatagt
gctctcaaacttgaaaacactagacttagcgaacgagttaaagaactcgaaataaaagaa
gggaaaaattaa

DBGET integrated database retrieval system