KEGG   Viruses: 8658815Help
Entry
8658815           CDS       T40000                                 

Gene name
B, EP-D108_gp04
Definition
(RefSeq) Escherichia phage D108; DNA transposition protein B
  KO
K07132  ATP-dependent target DNA activator [EC:3.6.1.3]
Taxonomy
TAX:665033
  Lineage
Viruses; dsDNA viruses, no RNA stage; Caudovirales; Myoviridae; Muvirus; unclassified Mu-like viruses
Taxonomy
Organism
vg  Viruses
SSDB OrthologParalogGFIT
Motif
Pfam: Phage-MuB_C AAA_22 AAA_30 AAA_5 AAA_16 HTH_24 Death TniB LacI AAA_18 AAA_33 AAA_19 AAA Sigma54_activat Viral_helicase1
Motif
Other DBs
NCBI-GeneID: 8658815
NCBI-ProteinID: YP_003335752
RS: NC_013594
UniProt: P13771
Position
NC_013594:3306..4244
AA seq 312 aa AA seqDB search
MNISDIRAGLRTLVENEETTFKQIALESGLSTGTISSFINDKYNGDNERVSQMLQRWLEK
YHAVAELPEPPRFVETQTVKQIWTSMRFASLTESIAVVCGNPGVGKTEAAREYRRTNNNV
WMITITPSCASVLECLTELAFELGMNDAPRRKGPLSRALRRRLEGTQGLVIIDEADHLGA
EVLEELRLLQESTRTGLVLMGNHRVYSNMTGGNRTVEFARLFSRIAKRTAINKTKKADVK
AIADAWQINGENELELLQQIAQKPGALRILNHSLRLAAMTAHGKGERVNEDYLRQAFREL
DLDVDISTLLRN
NT seq 939 nt NT seq  +upstreamnt  +downstreamnt
atgaatatttccgatattcgcgcaggactgcgcacgcttgtagaaaatgaagaaaccacc
tttaaacaaattgctcttgagagcggactttctaccggaactatcagtagttttatcaat
gataagtacaacggggataacgagcgtgtttcacaaatgctgcaacgctggctggaaaaa
tatcatgcagttgcagaactacctgaaccgccccgctttgtggaaacgcagacggtaaaa
caaatctggacaagtatgcgttttgccagcctgactgaaagtattgctgttgtatgtggc
aatcctggtgtgggcaaaaccgaagcggcccgtgaatatcgccgcaccaataacaatgtc
tggatgatcaccattacgccatcctgtgccagcgttctggaatgtcttactgaactggcg
tttgagctgggaatgaatgacgcaccacgccgtaaagggccgctctcccgcgccctgcga
cgtcgccttgaaggtacacaggggctggttatcatcgacgaagctgatcatcttggtgcc
gaagttctggaagaactccgcctgttacaggaatcaacccgcactggccttgtgctgatg
ggaaatcaccgggtttattcaaatatgacggggggtaacagaacggttgaatttgcccgt
ctgttttcccgtattgcaaagcgcactgcaattaataaaaccaaaaaagccgatgtaaaa
gctattgcggatgcctggcagattaacggcgaaaatgaactggagttattacagcagatt
gcgcagaaaccaggtgcgcttcgcattctgaatcattcacttcgccttgccgccatgacg
gctcacggtaaaggtgagcgtgttaacgaagattatctgcgtcaggctttccgtgaatta
gacctggacgttgatatttcaacgctgctgcgtaattaa

DBGET integrated database retrieval system