KEGG   Viruses: 8797333
Entry
8797333           CDS       T40000                                 

Gene name
PCPV_gp132
Definition
(RefSeq) Pseudocowpox virus; VEGF
  KO
K22612  Poxvirus vascular endothelial growth factor A homolog
Taxonomy
TAX:129726
  Lineage
Viruses; dsDNA viruses; Varidnaviria; Bamfordvirae; Nucleocytoviricota; Pokkesviricetes; Chitovirales; Poxviridae; Chordopoxvirinae; Parapoxvirus
Organism
vg  Viruses (Pseudocowpox virus)
SSDB
Motif
Pfam: PDGF
Other DBs
NCBI-GeneID: 8797333
NCBI-ProteinID: YP_003457435
RS: NC_013804
UniProt: Q8B571
Position
NC_013804:139289..139747
AA seq 152 aa
MKLITTLQFAVALLICMYNLPECFSGSTGGSSSGGSSSASSLSSWLDTSEKSSCKPRDTV
VQLISEYPGDVEQRYNPRCVTVRRCGGCCNDESQICTAIETANVTVTVMLTGVSGSTGAT
SNFQTISVEEHTKCKCEFQTSPPTTTTTKEPR
NT seq 459 nt   +upstreamnt  +downstreamnt
atgaagttgataactacgttacaatttgcggtagcgttgttgatatgtatgtataattta
ccagaatgcttttctggatctacgggaggtagttctagtggtggaagcagttctgcatca
tcgttaagtagttggttagatacgtcagaaaagagcagttgtaaacctagagatactgta
gttcagttaatatctgagtatccaggagacgtagaacaaaggtacaatccaagatgtgtc
acagttagaagatgtggtggttgttgtaacgacgaatctcaaatatgtactgctatagaa
acagcaaacgtaaccgttacagttatgttaacaggtgtttctggatctacaggcgcaact
agtaacttccaaactataagtgttgaagaacatacaaagtgcaagtgtgagtttcagacg
tcaccaccaactacaacaacaacaaaagaacctagataa

DBGET integrated database retrieval system