KEGG   Viruses: 912267Help
Entry
912267            CDS       T40000                                 

Gene name
POLY, WNVgp1
Definition
(RefSeq) West Nile virus; polyprotein
Taxonomy
TAX:11082 [GN:T40029]
  Lineage
Viruses; ssRNA viruses; Flaviviridae; Flavivirus
Taxonomy
Organism
vg  Viruses (West Nile virus)
SSDB OrthologParalogGFIT
Motif
Pfam: Flavi_NS5 Flavi_NS1 Flavi_glycoprot Flavi_DEAD Flavi_NS4B Flavi_capsid Flavi_NS4A Peptidase_S7 Flavi_glycop_C Flavi_NS2A Flavi_propep Flavi_NS2B Flavi_M FtsJ Peptidase_S29 Helicase_C AAA_19 ResIII Trypsin_2 Methyltransf_23
Motif
Other DBs
NCBI-GeneID: 912267
NCBI-ProteinID: NP_041724
RS: NC_001563
UniProt: P06935
Structure
PDB: 

Position
NC_001563:97..10389
AA seq 3430 aa AA seqDB search
MSKKPGGPGKNRAVNMLKRGMPRGLSLIGLKRAMLSLIDGKGPIRFVLALLAFFRFTAIA
PTRAVLDRWRGVNKQTAMKHLLSFKKELGTLTSAINRRSTKQKKRGGTAGFTILLGLIAC
AGAVTLSNFQGKVMMTVNATDVTDVITIPTAAGKNLCIVRAMDVGYLCEDTITYECPVLA
AGNDPEDIDCWCTKSSVYVRYGRCTKTRHSRRSRRSLTVQTHGESTLANKKGAWLDSTKA
TRYLVKTESWILRNPGYALVAAVIGWMLGSNTMQRVVFAILLLLVAPAYSFNCLGMSNRD
FLEGVSGATWVDLVLEGDSCVTIMSKDKPTIDVKMMNMEAANLADVRSYCYLASVSDLST
RAACPTMGEAHNEKRADPAFVCKQGVVDRGWGNGCGLFGKGSIDTCAKFACTTKATGWII
QKENIKYEVAIFVHGPTTVESHGKIGATQAGRFSITPSAPSYTLKLGEYGEVTVDCEPRS
GIDTSAYYVMSVGEKSFLVHREWFMDLNLPWSSAGSTTWRNRETLMEFEEPHATKQSVVA
LGSQEGALHQALAGAIPVEFSSNTVKLTSGHLKCRVKMEKLQLKGTTYGVCSKAFKFART
PADTGHGTVVLELQYTGTDGPCKVPISSVASLNDLTPVGRLVTVNPFVSVATANSKVLIE
LEPPFGDSYIVVGRGEQQINHHWHKSGSSIGKAFTTTLRGAQRLAALGDTAWDFGSVGGV
FTSVGKAIHQVFGGAFRSLFGGMSWITQGLLGALLLWMGINARDRSIAMTFLAVGGVLLF
LSVNVHADTGCAIDIGRQELRCGSGVFIHNDVEAWMDRYKFYPETPQGLAKIIQKAHAEG
VCGLRSVSRLEHQMWEAIKDELNTLLKENGVDLSVVVEKQNGMYKAAPKRLAATTEKLEM
GWKAWGKSIIFAPELANNTFVIDGPETEECPTANRAWNSMEVEDFGFGLTSTRMFLRIRE
TNTTECDSKIIGTAVKNNMAVHSDLSYWIESGLNDTWKLERAVLGEVKSCTWPETHTLWG
DGVLESDLIIPITLAGPRSNHNRRPGYKTQNQGPWDEGRVEIDFDYCPGTTVTISDSCEH
RGPAARTTTESGKLITDWCCRSCTLPPLRFQTENGCWYGMEIRPTRHDEKTLVQSRVNAY
NADMIDPFQLGLMVVFLATQEVLRKRWTAKISIPAIMLALLVLVFGGITYTDVLRYVILV
GAAFAEANSGGDVVHLALMATFKIQPVFLVASFLKARWTNQESILLMLAAAFFQMAYYDA
KNVLSWEVPDVLNSLSVAWMILRAISFTNTSNVVVPLLALLTPGLKCLNLDVYRILLLMV
GVGSLIKEKRSSAAKKKGACLICLALASTGVFNPMILAAGLMACDPNRKRGWPATEVMTA
VGLMFAIVGGLAELDIDSMAIPMTIAGLMFAAFVISGKSTDMWIERTADITWESDAEITG
SSERVDVRLDDDGNFQLMNDPGAPWKIWMLRMACLAISAYTPWAILPSVIGFWITLQYTK
RGGVLWDTPSPKEYKKGDTTTGVYRIMTRGLLGSYQAGAGVMVEGVFHTLWHTTKGAALM
SGEGRLDPYWGSVKEDRLCYGGPWKLQHKWNGHDEVQMIVVEPGKNVKNVQTKPGVFKTP
EGEIGAVTLDYPTGTSGSPIVDKNGDVIGLYGNGVIMPNGSYISAIVQGERMEEPAPAGF
EPEMLRKKQITVLDLHPGAGKTRKILPQIIKEAINKRLRTAVLAPTRVVAAEMSEALRGL
PIRYQTSAVHREHSGNEIVDVMCHATLTHRLMSPHRVPNYNLFIMDEAHFTDPASIAARG
YIATKVELGEAAAIFMTATPPGTSDPFPESNAPISDMQTEIPDRAWNTGYEWITEYVGKT
VWFVPSVKMGNEIALCLQRAGKKVIQLNRKSYETEYPKCKNDDWDFVITTDISEMGANFK
ASRVIDSRKSVKPTIIEEGDGRVILGEPSAITAASAAQRRGRIGRNPSQVGDEYCYGGHT
NEDDSNFAHWTEARIMLDNINMPNGLVAQLYQPEREKVYTMDGEYRLRGEERKNFLEFLR
TADLPVWLAYKVAAAGISYHDRKWCFDGPRTNTILEDNNEVEVITKLGERKILRPRWADA
RVYSDHQALKSFKDFASGKRSQIGLVEVLGRMPEHFMVKTWEALDTMYVVATAEKGGRAH
RMALEELPDALQTIVLIALLSVMSLGVFFLLMQRKGIGKIGLGGVILGAATFFCWMAEVP
GTKIAGMLLLSLLLMIVLIPEPEKQRSQTDNQLAVFLICVLTLVGAVAANEMGWLDKTKN
DIGSLLGHRPEARETTLGVESFLLDLRPATAWSLYAVTTAVLTPLLKHLITSDYINTSLT
SINVQASALFTLARGFPFVDVGVSALLLAVGCWGQVTLTVTVTAAALLFCHYAYMVPGWQ
AEAMRSAQRRTAAGIMKNVVVDGIVATDVPELERTTPVMQKKVGQIILILVSMAAVVVNP
SVRTVREAGILTTAAAVTLWENGASSVWNATTAIGLCHIMRGGWLSCLSIMWTLIKNMEK
PGLKRGGAKGRTLGEVWKERLNHMTKEEFTRYRKEAITEVDRSAAKHARREGNITGGHPV
SRGTAKLRWLVERRFLEPVGKVVDLGCGRGGWCYYMATQKRVQEVKGYTKGGPGHEEPQL
VQSYGWNIVTMKSGVDVFYRPSEASDTLLCDIGESSSSAEVEEHRTVRVLEMVEDWLHRG
PKEFCIKVLCPYMPKVIEKMETLQRRYGGGLIRNPLSRNSTHEMYWVSHASGNIVHSVNM
TSQVLLGRMEKKTWKGPQFEEDVNLGSGTRAVGKPLLNSDTSKIKNRIERLKKEYSSTWH
QDANHPYRTWNYHGSYEVKPTGSASSLVNGVVRLLSKPWDTITNVTTMAMTDTTPFGQQR
VFKEKVDTKAPEPPEGVKYVLNETTNWLWAFLARDKKPRMCSREEFIGKVNSNAALGAMF
EEQNQWKNAREAVEDPKFWEMVDEEREAHLRGECNTCIYNMMGKREKKPGEFGKAKGSRA
IWFMWLGARFLEFEALGFLNEDHWLGRKNSGGGVEGLGLQKLGYILKEVGTKPGGKVYAD
DTAGWDTRITKADLENEAKVLELLDGEHRRLARSIIELTYRHKVVKVMRPAADGKTVMDV
ISREDQRGSGQVVTYALNTFTNLAVQLVRMMEGEGVIGPDDVEKLGKGKGPKVRTWLFEN
GEERLSRMAVSGDDCVVKPLDDRFATSLHFLNAMSKVRKDIQEWKPSTGWYDWQQVPFCS
NHFTELIMKDGRTLVVPCRGQDELIGRARISPGAGWNVRDTACLAKSYAQMWLLLYFHRR
DLRLMANAICSAVPANWVPTGRTTWSIHAKGEWMTTEDMLAVWNRVWIEENEWMEDKTPV
ERWSDVPYSGKREDIWCGSLIGTRTRATWAENIHVAINQVRSVIGEEKYVDYMSSLRRYE
DTIVVEDTVL
NT seq 10293 nt NT seq  +upstreamnt  +downstreamnt
atgtctaagaaaccaggagggcccggtaaaaaccgggctgtcaatatgctaaaacgcggt
atgccccgcggattgtccttgataggactaaagagggctatgctgagtctgattgacggg
aagggcccaatacgtttcgtgttggctcttttggcgtttttcagattcactgcaatcgct
ccgactcgtgcggtgctggacagatggagaggcgtcaacaaacaaacagcaatgaagcat
ctcttgagtttcaagaaagaactaggaactctgaccagtgccatcaaccgccggagcaca
aaacaaaagaaaagaggaggcacagcgggctttactatcttgcttgggctgatcgcctgt
gctggagctgtgaccctctcgaacttccagggcaaagtgatgatgacagtcaatgcaacc
gatgtcactgacgtgattaccattccaacagctgctgggaaaaacctgtgcatcgtaagg
gctatggacgtaggatacctttgtgaggatactatcacttatgaatgtccggtcctagct
gctggaaatgaccctgaagacattgactgctggtgcacgaaatcatctgtttacgtgcgc
tatggaagatgcacaaaaactcggcattcccgtcgaagcagaaggtctctgacagtccag
acacatggagaaagtacactggccaacaagaaaggagcttggttggacagcacaaaagcc
acgagatatctggtgaagacagaatcatggatactgagaaacccgggctacgccctcgtt
gcagctgtcattggatggatgctaggaagcaacacaatgcaacgcgtcgtgtttgccatt
ctattgctcctggtggcaccagcatacagcttcaactgtttaggaatgagtaacagagac
ttcctggagggagtgtctggagctacatgggttgatctggtactggaaggcgatagttgt
gtgaccataatgtcaaaagacaagccaaccattgatgtcaaaatgatgaacatggaagca
gccaacctcgcagatgtgcgcagttactgttacctagcttcggtcagtgacttgtcaaca
agagctgcgtgtccaaccatgggtgaagcccacaacgagaaaagagctgaccccgccttc
gtttgcaagcaaggcgttgtggacagaggatggggaaatggctgcggactgtttggaaag
gggagcattgacacatgtgcgaagtttgcctgtacaaccaaagcaactggatggatcatc
cagaaggaaaacatcaagtatgaggttgccatatttgtgcatggcccgacgaccgttgaa
tctcatggcaagataggggccacccaggctggaagattcagtataactccatcggcgcca
tcttacacgctaaagttgggtgagtatggtgaggttacggttgattgtgagccacggtca
ggaatagacaccagcgcctattacgttatgtcagttggtgagaagtccttcctggttcac
cgagaatggtttatggatctgaacctgccatggagcagtgctggaagcaccacgtggagg
aaccgggaaacactgatggagtttgaagaacctcatgccaccaaacaatctgttgtggct
ctagggtcgcaggaaggtgcgttgcaccaagctctggccggagcgattcctgttgagttc
tcaagcaacactgtgaagttgacatcaggacatctgaagtgtcgggtgaagatggagaag
ttgcagctgaagggaacaacatatggagtatgttcaaaagcgttcaaattcgctaggact
cccgctgacactggccacggaacggtggtgttggaactgcaatataccggaacagacggt
ccctgcaaagtgcccatttcttccgtagcttccctgaatgacctcacacctgttggaaga
ctggtgaccgtgaatccatttgtgtctgtggccacagccaactcgaaggttttgattgaa
ctcgaacccccgtttggtgactcttacatcgtggtgggaagaggagaacagcagataaac
catcactggcacaaatctgggagcagcattggaaaggcctttaccaccacactcagagga
gctcaacgactcgcagctcttggagatactgcttgggattttggatcagttggaggggtt
ttcacctcagtggggaaagccatacaccaagtctttggaggagcttttagatcactcttt
ggagggatgtcctggatcacacagggacttctgggagctcttctgttgtggatgggaatc
aatgcccgtgacaggtcaattgctatgacgtttcttgcggttggaggagttttgctcttc
ctttcggtcaacgtccatgctgacacaggctgtgccattgatattggcaggcaagagctc
cggtgcggaagtggagtgtttatccacaacgatgtggaagcctggatggatcgttacaag
ttctacccggagacgccacagggcctagcaaaaattatccagaaagcacatgcagaagga
gtctgcggcttgcgttccgtttccagactcgagcaccaaatgtgggaagccattaaggat
gagctgaacaccctgttgaaagagaatggagtcgacttgagtgtcgtggtggaaaaacag
aatgggatgtacaaagcagcaccaaaacgtttggctgccaccaccgaaaaactggagatg
ggttggaaggcttggggcaagagtatcatctttgcgccagaactagctaacaacaccttt
gtcatcgacggtcctgagactgaggaatgcccaacggccaaccgagcatggaacagtatg
gaggtagaggactttggatttggactgacaagcactcgcatgttcctgaggattcgggaa
acgaacacaacggaatgcgactcgaagatcataggaaccgccgtcaagaacaacatggct
gtgcatagtgatctatcatactggatagagagcggactcaacgacacctggaagcttgag
agggcggttctaggagaagtcaaatcatgcacctggccagaaacccacactctgtggggt
gatggagttctggaaagtgatctcatcatacccatcaccttggcaggacccagaagcaac
cacaacaggagaccagggtacaaaactcagaaccaaggcccatgggatgaggggcgcgtc
gagattgactttgactattgcccaggaacaacagtaactataagtgacagttgcgaacac
cgtggacctgcggcacgcacaaccactgagagtgggaagctcatcacagactggtgctgc
agaagttgcaccctccctccactgcgcttccagactgagaatggctgttggtatggaatg
gaaattcgacctacgcggcacgacgaaaagaccctcgtgcaatcgagagtgaatgcatac
aacgccgacatgattgatccttttcagttgggccttatggtcgtgttcttggccacccag
gaggtccttcgcaagaggtggacggccaagatcagcattccagctatcatgcttgcactc
ctagtcctagtgtttgggggtattacgtacactgatgtcctgcgatatgtcattctcgtc
ggcgccgcgtttgctgaagcaaactcaggaggagacgtcgtgcacttggcacttatggct
acattcaagattcaaccagtctttctggtggcttcctttttgaaggcaaggtggaccaac
caagagagtattttgctcatgcttgcagctgctttcttccaaatggcttactatgacgcc
aagaatgttctgtcatgggaagtgcctgacgttttgaactctctctccgttgcgtggatg
attctcagagctataagcttcaccaacacttcaaatgtggtggtgccgctgctggccctt
ttgacacctggattgaaatgcttaaaccttgatgtgtacagaattttgctactcatggtt
ggagttggaagcctcatcaaagaaaaaaggagctctgcagcaaaaaagaaaggagcttgc
ctcatctgcctagcgctggcgtctacaggagtgttcaatccaatgatacttgcagctggg
ctaatggcttgcgaccccaaccgcaagcggggctggcctgctacagaagtgatgactgca
gttggactcatgtttgccatcgttgggggtctggcagaacttgacatagattctatggct
atccccatgaccatcgccggacttatgttcgcggcatttgtcatctctggaaagtcaaca
gacatgtggattgagaggacggctgacattacttgggagagtgatgctgaaatcacaggc
tctagcgaaagagtagatgtgaggctggatgatgatggaaattttcaactgatgaatgac
cccggggcaccatggaaaatttggatgcttaggatggcctgcctggcgataagtgcctac
acaccttgggcaattctcccctcggtcatcggattctggataacccttcagtacacaaag
agaggaggtgttctttgggacacaccatcacccaaggagtacaagaagggtgataccacc
actggcgtttacagaatcatgactcgaggtctgcttggcagttaccaagctggagccgga
gtgatggtagagggggtgttccacacactatggcacaccactaagggagctgctctcatg
agtggtgagggacgtctggatccctactgggggagcgtgaaagaggaccgactttgctat
ggggggccatggaaactccaacataaatggaatggacatgatgaggtccaaatgattgtc
gtggagccagggaaaaatgtgaaaaacgtccagaccaagcccggagtgtttaagacacca
gaaggagaaattggggcagttacgctagactatcctaccggaacgtcaggttcccccatt
gtagacaaaaatggagatgtgattggattgtatgggaacggcgtcatcatgcctaatggt
tcatacataagcgccattgtgcaaggagagagaatggaagaaccggcaccagctggcttc
gaacctgaaatgttgaggaagaaacagatcactgtccttgatctgcaccccggagcagga
aagacacgcaagatacttccccaaatcatcaaggaggccatcaacaaaagattgaggacg
gctgtgctggcacccaccagggtcgttgctgctgagatgtctgaggccctgagaggactt
cccattcggtaccaaacctcagcagtgcacagagagcacagtggaaatgagatcgttgat
gtcatgtgccatgccaccctcacacacaggctgatgtctccacacagagtccccaactac
aacctgttcataatggatgaagcccatttcacggatccagcgagcatcgcagccagagga
tacatagcaaccaaggttgaattgggcgaagccgccgcgattttcatgacggcaacgcca
cccgggacttctgacccctttccagagtctaatgctcctatctcggacatgcaaacagag
atcccagacagagcctggaacactggatatgaatggataactgagtatgttggaaagacc
gtttggtttgttccaagtgtgaaaatgggaaatgagattgccctctgtctgcaacgggcg
gggaagaaggttatccagctgaacagaaagtcctatgagacagagtaccccaagtgtaag
aacgatgattgggattttgtcatcaccacagacatatcagaaatgggagccaacttcaag
gcgagcagagtgatcgacagccgcaaaagcgtgaaacccaccatcattgaggaaggtgat
ggaagagtcatcctgggggaaccctcagccatcacggctgccagcgctgctcagcggaga
ggacgcataggaagaaacccatcacaagttggtgatgagtattgctatggagggcacaca
aatgaggatgattccaactttgctcactggacagaggctcgcatcatgctagacaacatc
aacatgccgaatggtctggtggctcaactatatcagcctgagcgcgagaaggtgtacacc
atggacggggaatacaggctcagaggggaagaacggaagaacttccttgaattcctgaga
acagctgatttaccagtctggctcgcttacaaagtggcagcagcaggaatatcataccat
gaccggaaatggtgctttgatggacctcgaaccaacacgattcttgaagacaacaatgaa
gttgaagtcatcacgaagttgggtgagagaaagatcctaagacccaggtgggcagatgct
agagtgtactcagaccatcaagctctaaagtccttcaaagattttgcatcggggaaacga
tcacaaatcgggctcgttgaggtgctcgggagaatgcctgaacacttcatggtgaaaact
tgggaggcattggacacgatgtatgtggtggcgaccgctgaaaaaggaggccgagctcac
aggatggctcttgaggagctaccggacgcccttcagacaatagttttgattgcactattg
agtgtgatgtccttaggtgtgttttttctactcatgcaaaggaagggcattggtaagatt
ggcttgggaggagtaatcttaggagctgccacattcttctgctggatggctgaagtccca
ggaacgaaaatagcaggcatgctcctgctttccctgctgctcatgattgttttgattccg
gagccggaaaagcagcgctcacagactgataaccagctcgccgtgttcttgatctgtgtg
ctcacactggtcggcgccgtggctgccaatgaaatgggctggctggacaagaccaagaat
gacattggcagcctgttggggcacaggccagaagctagagagacgaccctgggagttgag
agcttcttacttgatctgcggccggccacggcatggtcgctctatgccgtaacgacagcc
gttctcacccctttgctgaagcatctaatcacgtcagactacatcaacacttcgttgacc
tcaataaacgtccaagccagcgcgttgttcactttggccagaggcttcccttttgtggac
gttggtgtgtcagctctcttgctggcggtcgggtgctggggtcaggtgactctgactgtg
actgtgactgcagctgctctgctcttttgccactatgcttacatggtgccaggctggcaa
gcggaagccatgcgatctgcccagcggcggacagctgctggcatcatgaaaaatgtagtg
gtggatgggatcgtggccactgatgtacctgaacttgaacgaacaactccagtcatgcag
aaaaaagttggacagatcatattgatcttggtatcaatggccgcggtggtcgtcaatcca
tcagtgagaaccgtcagagaggccggaattctgactacagcagcagcagtcaccctatgg
gagaatggtgctagttcagtgtggaatgcaacgacagctattggcctttgtcacatcatg
cgaggaggatggctctcgtgtctctccatcatgtggactctcatcaaaaacatggagaaa
ccaggcctcaagaggggtggagccaaaggacgcacgctaggggaagtttggaaggagaga
ctcaaccacatgacgaaggaagaatttaccagatacagaaaagaagccatcactgaagtt
gaccgctccgcagcaaaacatgctaggagagagggaaacatcactggaggccacccagtc
tcacggggaaccgcgaaattacggtggttagtggaaaggcgtttcctcgagccagtggga
aaggttgtggatctcgggtgtggtagaggcggctggtgctattacatggctacccagaag
agggtacaggaagtgaaagggtacacgaaaggaggacctggccatgaagaaccacaactg
gtgcagagctatggttggaatattgttaccatgaagagtggagtcgacgtcttctacaga
ccatcagaagcgagcgacacactgctctgtgacattggagagtcatcgtcaagtgccgag
gtagaagaacaccgcaccgtccgtgtcctggagatggtggaagattggttgcacagagga
ccgaaggaattctgcatcaaagtgctatgcccttacatgcccaaagtgattgagaagatg
gaaacactccaaaggcgatatggaggtggccttataagaaaccccctttcacgcaactct
acccatgagatgtactgggtgagccacgcttcaggcaatatcgtccactccgtcaacatg
acaagccaggtgcttctggggaggatggaaaagaaaacatggaagggaccccagtttgag
gaagatgtcaacttgggaagtggaacgcgggcagtagggaagcctctcctcaattctgat
actagcaagatcaagaaccgaattgagaggctgaagaaagaatacagctccacatggcac
caggatgcgaaccacccctacaggacctggaactaccacggaagctatgaagtgaaacca
accggctcagccagctcccttgtgaatggggtagtcagattactctcaaaaccatgggac
actatcaccaatgtgaccacgatggccatgacagacaccactcctttcggtcaacaacga
gtgttcaaggaaaaggtggacacaaaggctccagagcctccagaaggagtcaaatacgtc
ctcaatgagaccacgaactggctgtgggcttttttagcccgcgataagaaacccaggatg
tgttcccgggaggaatttattggaaaagtcaacagtaatgccgccctaggagcgatgttt
gaagaacagaaccaatggaagaacgcccgggaagctgtagaggatccaaagttttgggag
atggtggatgaggagcgtgaagcgcatctccgtggagaatgcaacacctgcatctacaac
atgatgggaaagagagagaagaagcctggagagttcggcaaagctaaaggcagcagagcc
atctggttcatgtggctgggggcccgcttcctggagtttgaagctctcggattcctcaat
gaagaccactggctgggtaggaagaactcaggaggaggagttgaaggcttaggactgcag
aagctcgggtacatcttgaaggaagttggaacaaagcctggaggaaaggtttacgctgat
gataccgcaggctgggacacacgcatcaccaaagctgacctcgagaatgaagcgaaggtt
cttgaactgctggatggagaacatcgacgtttagcgcggtccatcatcgagctcacatac
cgacacaaagtcgtgaaagtgatgaggccagcggccgacgggaaaactgtgatggacgtc
atctctagagaggatcagagaggaagcggtcaggtagtgacttacgccctgaacaccttc
accaatctagcagttcagctggtcagaatgatggagggggagggggtcattggacccgat
gatgttgaaaaactgggaaaaggaaaaggccctaaggtcagaacctggctgtttgagaat
ggcgaggagcgtctcagtcgcatggccgtcagcggtgatgactgcgtggtgaaacctttg
gacgaccgcttcgccacatcactacacttcctaaatgctatgtcaaaggtccgcaaagac
atccaggaatggaaaccctcgacggggtggtatgactggcagcaggttccattctgttca
aaccatttcacggaactgatcatgaaggacggcaggacgctggtggtcccgtgtcgtgga
caagacgagttgattggacgtgccaggatctctccaggggctggatggaatgtgcgcgac
accgcctgcctggcgaagtcatacgcgcagatgtggctgctgctttatttccaccgtaga
gacctgagattgatggccaatgccatctgttccgctgtgcctgccaactgggttcccaca
gggcgtaccacttggtcgatccacgcaaaaggagaatggatgacgacggaagacatgctc
gcagtctggaacagagtgtggattgaggagaatgagtggatggaagacaaaacaccagtt
gagaggtggagtgatgttccatactctggaaagagagaggacatttggtgtggcagtttg
atcggcacacgaacccgcgccacttgggctgaaaatatccatgtggcaatcaatcaggtc
cgttcagtgattggagaagagaagtatgtggattacatgagctccttgaggaggtatgaa
gacaccattgtagtggaggacactgttttgtaa

DBGET integrated database retrieval system