KEGG   Viruses: 919920Help
Entry
919920            CDS       T40000                                 

Gene name
PVgp1
Definition
(RefSeq) Enterovirus C; genome polyprotein
Taxonomy
TAX:138950 [GN:T40105]
  Lineage
Viruses; ssRNA viruses; Picornavirales; Picornaviridae; Enterovirus
Taxonomy
Organism
vg  Viruses (Enterovirus C)
SSDB OrthologParalogGFIT
Motif
Pfam: Rhv RdRP_1 Pico_P2A Peptidase_C3 Pico_P2B Pico_P1A P3A RNA_helicase RdRP_4 Calici_coat AAA_16 DUF2075 Torsin Zeta_toxin ATPgrasp_TupA MitoNEET_N PcF
Motif
Other DBs
NCBI-GeneID: 919920
NCBI-ProteinID: NP_041277
RS: NC_002058
UniProt: P03300
Structure
PDB: 

Position
NC_002058:743..7372
AA seq 2209 aa AA seqDB search
MGAQVSSQKVGAHENSNRAYGGSTINYTTINYYRDSASNAASKQDFSQDPSKFTEPIKDV
LIKTAPMLNSPNIEACGYSDRVLQLTLGNSTITTQEAANSVVAYGRWPEYLRDSEANPVD
QPTEPDVAACRFYTLDTVSWTKESRGWWWKLPDALRDMGLFGQNMYYHYLGRSGYTVHVQ
CNASKFHQGALGVFAVPEMCLAGDSNTTTMHTSYQNANPGEKGGTFTGTFTPDNNQTSPA
RRFCPVDYLLGNGTLLGNAFVFPHQIINLRTNNCATLVLPYVNSLSIDSMVKHNNWGIAI
LPLAPLNFASESSPEIPITLTIAPMCCEFNGLRNITLPRLQGLPVMNTPGSNQYLTADNF
QSPCALPEFDVTPPIDIPGEVKNMMELAEIDTMIPFDLSATKKNTMEMYRVRLSDKPHTD
DPILCLSLSPASDPRLSHTMLGEILNYYTHWAGSLKFTFLFCGFMMATGKLLVSYAPPGA
DPPKKRKEAMLGTHVIWDIGLQSSCTMVVPWISNTTYRQTIDDSFTEGGYISVFYQTRIV
VPLSTPREMDILGFVSACNDFSVRLLRDTTHIEQKALAQGLGQMLESMIDNTVRETVGAA
TSRDALPNTEASGPTHSKEIPALTAVETGATNPLVPSDTVQTRHVVQHRSRSESSIESFF
ARGACVTIMTVDNPASTTNKDKLFAVWKITYKDTVQLRRKLEFFTYSRFDMELTFVVTAN
FTETNNGHALNQVYQIMYVPPGAPVPEKWDDYTWQTSSNPSIFYTYGTAPARISVPYVGI
SNAYSHFYDGFSKVPLKDQSAALGDSLYGAASLNDFGILAVRVVNDHNPTKVTSKIRVYL
KPKHIRVWCPRPPRAVAYYGPGVDYKDGTLTPLSTKDLTTYGFGHQNKAVYTAGYKICNY
HLATQDDLQNAVNVMWSRDLLVTESRAQGTDSIARCNCNAGVYYCESRRKYYPVSFVGPT
FQYMEANNYYPARYQSHMLIGHGFASPGDCGGILRCHHGVIGIITAGGEGLVAFSDIRDL
YAYEEEAMEQGITNYIESLGAAFGSGFTQQISDKITELTNMVTSTITEKLLKNLIKIISS
LVIITRNYEDTTTVLATLALLGCDASPWQWLRKKACDVLEIPYVIKQGDSWLKKFTEACN
AAKGLEWVSNKISKFIDWLKEKIIPQARDKLEFVTKLRQLEMLENQISTIHQSCPSQEHQ
EILFNNVRWLSIQSKRFAPLYAVEAKRIQKLEHTINNYIQFKSKHRIEPVCLLVHGSPGT
GKSVATNLIARAIAERENTSTYSLPPDPSHFDGYKQQGVVIMDDLNQNPDGADMKLFCQM
VSTVEFIPPMASLEEKGILFTSNYVLASTNSSRISPPTVAHSDALARRFAFDMDIQVMNE
YSRDGKLNMAMATEMCKNCHQPANFKRCCPLVCGKAIQLMDKSSRVRYSIDQITTMIINE
RNRRSNIGNCMEALFQGPLQYKDLKIDIKTSPPPECINDLLQAVDSQEVRDYCEKKGWIV
NITSQVQTERNINRAMTILQAVTTFAAVAGVVYVMYKLFAGHQGAYTGLPNKKPNVPTIR
TAKVQGPGFDYAVAMAKRNIVTATTSKGEFTMLGVHDNVAILPTHASPGESIVIDGKEVE
ILDAKALEDQAGTNLEITIITLKRNEKFRDIRPHIPTQITETNDGVLIVNTSKYPNMYVP
VGAVTEQGYLNLGGRQTARTLMYNFPTRAGQCGGVITCTGKVIGMHVGGNGSHGFAAALK
RSYFTQSQGEIQWMRPSKEVGYPIINAPSKTKLEPSAFHYVFEGVKEPAVLTKNDPRLKT
DFEEAIFSKYVGNKITEVDEYMKEAVDHYAGQLMSLDINTEQMCLEDAMYGTDGLEALDL
STSAGYPYVAMGKKKRDILNKQTRDTKEMQKLLDTYGINLPLVTYVKDELRSKTKVEQGK
SRLIEASSLNDSVAMRMAFGNLYAAFHKNPGVITGSAVGCDPDLFWSKIPVLMEEKLFAF
DYTGYDASLSPAWFEALKMVLEKIGFGDRVDYIDYLNHSHHLYKNKTYCVKGGMPSGCSG
TSIFNSMINNLIIRTLLLKTYKGIDLDHLKMIAYGDDVIASYPHEVDASLLAQSGKDYGL
TMTPADKSATFETVTWENVTFLKRFFRADEKYPFLIHPVMPMKEIHESIRWTKDPRNTQD
HVRSLCLLAWHNGEEEYNKFLAKIRSVPIGRALLLPEYSTLYRRWLDSF
NT seq 6630 nt NT seq  +upstreamnt  +downstreamnt
atgggtgctcaggtttcatcacagaaagtgggcgcacatgaaaactcaaatagagcgtat
ggtggttctaccattaattacaccaccattaattattatagagattcagctagtaacgcg
gcttcgaaacaggacttctctcaagacccttccaagttcaccgagcccatcaaggatgtc
ctgataaaaacagccccaatgctaaactcgccaaacatagaggcttgcgggtatagcgat
agagtactgcaattaacactgggaaactccactataaccacacaggaggcggctaattca
gtagtcgcttatgggcgttggcctgaatatctgagggacagcgaagccaatccagtggac
cagccgacagaaccagacgtcgctgcatgcaggttttatacgctagacaccgtgtcttgg
acgaaagagtcgcgagggtggtggtggaagttgcctgatgcactgagggacatgggactc
tttgggcaaaatatgtactaccactacctaggtaggtccgggtacaccgtgcatgtacag
tgtaacgcctccaaattccaccagggggcactaggggtattcgccgtaccagagatgtgt
ctggccggggatagcaacaccactaccatgcacaccagctatcaaaatgccaatcctggc
gagaaaggaggcactttcacgggtacgttcactcctgacaacaaccagacatcacctgcc
cgcaggttctgcccggtggattacctccttggaaatggcacgttgttggggaatgccttt
gtgttcccgcaccagataataaacctacggaccaacaactgtgctacactggtactccct
tacgtgaactccctctcgatagatagtatggtaaagcacaataattggggaattgcaata
ttaccattggccccattaaattttgctagtgagtcctccccagagattccaatcaccttg
accatagcccctatgtgctgtgagttcaatggattaagaaacatcaccctgccacgctta
cagggcctgccggtcatgaacacccctggtagcaatcaatatcttactgcagacaacttc
cagtcaccgtgtgcgctgcctgaatttgatgtgaccccacctattgacatacccggtgaa
gtaaagaacatgatggaattggcagaaatcgacaccatgattccctttgacttaagtgcc
acaaaaaagaacaccatggaaatgtatagggttcggttaagtgacaaaccacatacagac
gatcccatactctgcctgtcactctctccagcttcagatcctaggttgtcacatactatg
cttggagaaatcctaaattactacacacactgggcaggatccctgaagttcacgtttctg
ttctgtggattcatgatggcaactggcaaactgttggtgtcatacgcgcctcctggagcc
gacccaccaaagaagcgtaaggaggcgatgttgggaacacatgtgatctgggacatagga
ctgcagtcctcatgtactatggtagtgccatggattagcaacaccacgtatcggcaaacc
atagatgatagtttcaccgaaggcggatacatcagcgtcttctaccaaactagaatagtc
gtccctctttcgacacccagagagatggacatccttggttttgtgtcagcgtgtaatgac
ttcagcgtgcgcttgttgcgagataccacacatatagagcaaaaagcgctagcacagggg
ttaggtcagatgcttgaaagcatgattgacaacacagtccgtgaaacggtgggggcggca
acatctagagacgctctcccaaacactgaagccagtggaccaacacactccaaggaaatt
ccggcactcaccgcagtggaaactggggccacaaatccactagtcccttctgatacagtg
caaaccagacatgttgtacaacataggtcaaggtcagagtctagcatagagtctttcttc
gcgcggggtgcatgcgtgaccattatgaccgtggataacccagcttccaccacgaataag
gataagctatttgcagtgtggaagatcacttataaagatactgtccagttacggaggaaa
ttggagttcttcacctattctagatttgatatggaacttacctttgtggttactgcaaat
ttcactgagactaacaatgggcatgccttaaatcaagtgtaccaaattatgtacgtacca
ccaggcgctccagtgcccgagaaatgggacgactacacatggcaaacctcatcaaatcca
tcaatcttttacacctacggaacagctccagcccggatctcggtaccgtatgttggtatt
tcgaacgcctattcacacttttacgacggtttttccaaagtaccactgaaggaccagtcg
gcagcactaggtgactccctttatggtgcagcatctctaaatgacttcggtattttggct
gttagagtagtcaatgatcacaacccgaccaaggtcacctccaaaatcagagtgtatcta
aaacccaaacacatcagagtctggtgcccgcgtccaccgagggcagtggcgtactacggc
cctggagtggattacaaggatggtacgcttacacccctctccaccaaggatctgaccaca
tatggattcggacaccaaaacaaagcggtgtacactgcaggttacaaaatttgcaactac
cacttggccactcaggatgatttgcaaaacgcagtgaacgtcatgtggagtagagacctc
ttagtcacagaatcaagagcccagggcaccgattcaatcgcaaggtgcaattgcaacgca
ggggtgtactactgcgagtctagaaggaaatactacccagtatccttcgttggcccaacg
ttccagtacatggaggctaataactattacccagctaggtaccagtcccatatgctcatt
ggccatggattcgcatctccaggggattgtggtggcatactcagatgtcaccacggggtg
atagggatcattactgctggtggcgaagggttggttgcattttcagacattagagacttg
tatgcctacgaagaagaagccatggaacaaggcatcaccaattacatagagtcacttggg
gccgcatttggaagtggatttactcagcagattagcgacaaaataacagagttgaccaat
atggtgaccagtaccatcactgaaaagctacttaagaacttgatcaagatcatatcctca
ctagttattataactaggaactatgaagacaccacaacagtgctcgctaccctggccctt
cttgggtgtgatgcttcaccatggcagtggcttagaaagaaagcatgcgatgttctggag
ataccttatgtcatcaagcaaggtgacagttggttgaagaagtttactgaagcatgcaac
gcagctaagggactggagtgggtgtcaaacaaaatctcaaaattcattgattggctcaag
gagaaaattatcccacaagctagagataagttggaatttgtaacaaaacttagacaacta
gaaatgctggaaaaccaaatctcaactatacaccaatcatgccctagtcaggaacaccag
gaaattctattcaataatgtcagatggttatccatccagtctaagaggtttgcccctctt
tacgcagtggaagccaaaagaatacagaaactagagcatactattaacaactacatacag
ttcaagagcaaacaccgtattgaaccagtatgtttgctagtacatggcagccccggaaca
ggtaaatctgtagcaaccaacctgattgctagagccatagctgaaagagaaaacacgtcc
acgtactcgctacccccggatccatcacacttcgacggatacaaacaacagggagtggtg
attatggacgacctgaatcaaaacccagatggtgcggacatgaagctgttctgtcagatg
gtatcaacagtggagtttataccacccatggcatccctggaggagaaaggaatcctgttt
acttcaaattacgttctagcatccacaaactcaagcagaatttccccccccactgtggca
cacagtgatgcattagccaggcgctttgcgttcgacatggacattcaggtcatgaatgag
tattctagagatgggaaattgaacatggccatggctactgaaatgtgtaagaactgtcac
caaccagcaaactttaagagatgctgtcctttagtgtgtggtaaggcaattcaattaatg
gacaaatcttccagagttagatacagtattgaccagatcactacaatgattatcaatgag
agaaacagaagatccaacattggcaattgtatggaggctttgtttcaaggaccactccag
tataaagacttgaaaattgacatcaagacgagtccccctcctgaatgtatcaatgacttg
ctccaagcagttgactcccaggaggtgagagattactgtgagaagaagggttggatagtc
aacatcaccagccaggttcaaacagaaaggaacatcaacagggcaatgacaattctacaa
gcggtgacaaccttcgccgcagtggctggagttgtctatgtcatgtataaactgtttgct
ggacaccagggagcatacactggtttaccaaacaaaaaacccaacgtgcccaccattcgg
acagcaaaggtacaaggaccagggttcgattacgcagtggctatggctaaaagaaacatt
gttacagcaactactagcaagggagagttcactatgttaggagtccacgacaacgtggct
attttaccaacccacgcttcacctggtgaaagcattgtgatcgatggcaaagaagtggag
atcttggatgccaaagcgctcgaagatcaagcaggaaccaatcttgaaatcactataatc
actctaaagagaaatgaaaagttcagagacattagaccacatatacctactcaaatcact
gagacaaatgatggagtcttgatcgtgaacactagcaagtaccccaatatgtatgttcct
gtcggtgctgtgactgaacagggatatctaaatctcggtgggcgccaaactgctcgtact
ctaatgtacaactttccaaccagagcaggacagtgtggtggagtcatcacatgtactggg
aaagtcatcgggatgcatgttggtgggaacggttcacacgggtttgcagcggccctgaag
cgatcatacttcactcagagtcaaggtgaaatccagtggatgagaccttcgaaggaagtg
ggatatccaatcataaatgccccgtccaaaaccaagcttgaacccagtgctttccactat
gtgtttgaaggggtgaaggaaccagcagtcctcactaaaaacgatcccaggcttaagaca
gactttgaggaggcaattttctccaagtacgtgggtaacaaaattactgaagtggatgag
tacatgaaagaggcagtagaccactatgctggccagctcatgtcactagacatcaacaca
gaacaaatgtgcttggaggatgccatgtatggcactgatggtctagaagcacttgatttg
tccaccagtgctggctacccttatgtagcaatgggaaagaagaagagagacatcttgaac
aaacaaaccagagacactaaggaaatgcaaaaactgctcgacacatatggaatcaacctc
ccactggtgacttatgtaaaggatgaacttagatccaaaacaaaggttgagcaggggaaa
tccagattaattgaagcttctagtttgaatgactcagtggcaatgagaatggcttttggg
aacctatatgctgcttttcacaaaaacccaggagtgataacaggttcagcagtggggtgc
gatccagatttgttttggagcaaaattccggtattgatggaagagaagctgtttgctttt
gactacacagggtatgatgcatctctcagccctgcttggttcgaggcactaaagatggtg
cttgagaaaatcggattcggagacagagttgactacatcgactacctaaaccactcacac
cacctgtacaagaataaaacatactgtgtcaagggcggtatgccatctggctgctcaggc
acttcaatttttaactcaatgattaacaacttgattatcaggacactcttactgaaaacc
tacaagggcatagatttagaccacctaaaaatgattgcctatggtgatgatgtaattgct
tcctacccccatgaagttgacgctagtctcctagcccaatcaggaaaagactatggacta
actatgactccagctgacaaatcagctacatttgaaacagtcacatgggagaatgtaaca
ttcttgaagagattcttcagggcagacgagaaatacccatttcttattcatccagtaatg
ccaatgaaggaaattcatgaatcaattagatggactaaagatcctaggaacactcaggat
cacgttcgctctctgtgccttttagcttggcacaatggcgaagaagaatataacaaattc
ctagctaaaatcaggagtgtgccaattggaagagctttattgctcccagagtactcaaca
ttgtaccgccgttggcttgactcattttag

DBGET integrated database retrieval system