KEGG   Viruses: 920955
Entry
920955            CDS       T40000                                 

Gene name
G, Nvgp5
Definition
(RefSeq) Nipah henipavirus; attachment glycoprotein
  KO
K19247  Respirovirus hemagglutinin-neuraminidase [EC:3.2.1.18]
Taxonomy
TAX:121791 [GN:T40047]
  Lineage
Viruses; -ssRNA viruses; Riboviria; Orthornavirae; Negarnaviricota; Haploviricotina; Monjiviricetes; Mononegavirales; Paramyxoviridae; Orthoparamyxovirinae; Henipavirus
Organism
vg  Viruses (Nipah henipavirus)
SSDB
Motif
Pfam: HN Saf_2TM DUF1359 DUF3852
Other DBs
NCBI-GeneID: 920955
NCBI-ProteinID: NP_112027
RS: NC_002728
UniProt: Q9IH62 A0A1L7B8G8
Structure
PDB: 
2VSM 2VWD 3D11 3D12

Position
NC_002728:8943..10751
AA seq 602 aa
MPAENKKVRFENTTSDKGKIPSKVIKSYYGTMDIKKINEGLLDSKILSAFNTVIALLGSI
VIIVMNIMIIQNYTRSTDNQAVIKDALQGIQQQIKGLADKIGTEIGPKVSLIDTSSTITI
PANIGLLGSKISQSTASINENVNEKCKFTLPPLKIHECNISCPNPLPFREYRPQTEGVSN
LVGLPNNICLQKTSNQILKPKLISYTLPVVGQSGTCITDPLLAMDEGYFAYSHLERIGSC
SRGVSKQRIIGVGEVLDRGDEVPSLFMTNVWTPPNPNTVYHCSAVYNNEFYYVLCAVSTV
GDPILNSTYWSGSLMMTRLAVKPKSNGGGYNQHQLALRSIEKGRYDKVMPYGPSGIKQGD
TLYFPAVGFLVRTEFKYNDSNCPITKCQYSKPENCRLSMGIRPNSHYILRSGLLKYNLSD
GENPKVVFIEISDQRLSIGSPSKIYDSLGQPVFYQASFSWDTMIKFGDVLTVNPLVVNWR
NNTVISRPGQSQCPRFNTCPEICWEGVYNDAFLIDRINWISAGVFLDSNQTAENPVFTVF
KDNEILYRAQLASEDTNAQKTITNCFLLKNKIWCISLVEIYDTGDNVIRPKLFAVKIPEQ
CT
NT seq 1809 nt   +upstreamnt  +downstreamnt
atgccggcagaaaacaagaaagttagattcgaaaatactacttcagacaaagggaaaatt
cctagtaaagttattaagagctactacggaaccatggacattaagaaaataaatgaagga
ttattggacagcaaaatattaagtgctttcaacacagtaatagcattgcttggatctatc
gtgatcatagtgatgaatataatgatcatccaaaattacacaagatcaacagacaatcag
gccgtgatcaaagatgcgttgcagggtatccaacagcagatcaaagggcttgctgacaaa
atcggcacagagatagggcccaaagtatcactgattgacacatccagtaccattactatc
ccagctaacattgggctgttaggttcaaagatcagccagtcgactgcaagtataaatgag
aatgtgaatgaaaaatgcaaattcacactgcctcccttgaaaatccacgaatgtaacatt
tcttgtcctaacccactcccttttagagagtataggccacagacagaaggggtgagcaat
ctagtaggattacctaataatatttgcctgcaaaagacatctaatcagatattgaagcca
aagctgatttcatacactttacccgtagtcggtcaaagtggtacctgtatcacagaccca
ttgctggctatggacgagggctattttgcatatagccacctggaaagaatcggatcatgt
tcaagaggggtctccaaacaaagaataataggagttggagaggtactagacagaggtgat
gaagttccttctttatttatgaccaatgtctggaccccaccaaatccaaacaccgtttac
cactgtagtgctgtatacaacaatgaattctattatgtactttgtgcagtgtcaactgtt
ggagaccctattctgaatagcacctactggtccggatctctaatgatgacccgtctagct
gtgaaacccaagagtaatggtgggggttacaatcaacatcaacttgccctacgaagtatc
gagaaagggaggtatgataaagttatgccgtatggaccttcaggcatcaaacagggtgac
accctgtattttcctgctgtaggatttttggtcaggacagagtttaaatacaatgattca
aattgtcccatcacgaagtgtcaatacagtaaacctgaaaattgcaggctatctatgggg
attagaccaaacagccattatatccttcgatctggactattaaaatacaatctatcagat
ggggagaaccccaaagttgtattcattgaaatatctgatcaaagattatctattggatct
cctagcaaaatctatgattctttgggtcaacctgttttctaccaagcgtcattttcatgg
gatactatgattaaatttggagatgttctaacagtcaaccctctggttgtcaattggcgt
aataacacggtaatatcaagacccgggcaatcacaatgccctagattcaatacatgtcca
gagatctgctgggaaggagtttataatgatgcattcctaattgacagaatcaattggata
agcgcgggtgtattccttgacagcaatcagaccgcagaaaatcctgtttttactgtattc
aaagataatgaaatactttatagggcacaactggcttctgaggacaccaatgcacaaaaa
acaataactaattgttttctcttgaagaataagatttggtgcatatcattggttgagata
tatgacacaggagacaatgtcataagacccaaactattcgcggttaagataccagagcaa
tgtacataa

DBGET integrated database retrieval system