KEGG   Viruses: 927415
Entry
927415            CDS       T40000                                 

Gene name
T3p38
Definition
(RefSeq) Enterobacteria phage T3; capsid assembly protein
Taxonomy
TAX:10759
  Lineage
Viruses; dsDNA viruses; Duplodnaviria; Heunggongvirae; Uroviricota; Caudoviricetes; Caudovirales; Autographiviridae; Studiervirinae; Teetrevirus; Escherichia virus T3
Organism
vg  Viruses (Escherichia virus T3)
SSDB
Motif
Pfam: Phage_T7_Capsid
Other DBs
NCBI-GeneID: 927415
NCBI-ProteinID: NP_523333
RS: NC_003298
UniProt: P20324 Q778N2
Position
NC_003298:19802..20734
AA seq 310 aa
MAESNADVYASFGVNNAVMTGSTPTEHEQNMLSLDVAARDGDDAIVLSDEPTSHNDDPYA
AGVDPFADGEDDEGRIQVRISEDGNEAGFDTDGDNSEVETEGEDVEFEPLGDTPEELSQV
TEQLGQHEEGFQAMVEQAVERGLSADSVSRIYEEYEADGISEKSYAELEAAGYSRAFVDS
YISGQEALVDQYVNQVVAFAGGQERFSAIHTHLEATNPAAAESLESAMMNRDLATVKAII
NLAGESYTKKFGKPANRSVTKRATPVKPVARQKEGFTNQAEMIKAMSDPRYRSDSAYRQM
VEQKVIDSSF
NT seq 933 nt   +upstreamnt  +downstreamnt
atggctgaatctaatgcagacgtttatgcgtccttcggtgtgaacaacgcggtaatgacc
ggaagcacacctactgaacacgaacagaatatgctgagtctcgacgttgctgcccgtgat
ggcgatgatgcaatcgtgcttagcgatgaaccgacttcccataacgatgacccctatgcg
gcaggtgtagacccgttcgctgatggtgaagatgatgagggccgcattcaggttcgtatc
agtgaagatggcaatgaagccgggttcgacactgatggcgataactctgaggtggagacc
gaaggtgaggacgttgagtttgaaccgctgggtgacaccccagaagaactaagccaagtg
actgagcaattaggtcagcacgaagaaggctttcaggcgatggtcgagcaggcagttgag
cgtggactgagcgcagactctgtgagtcgaatctacgaagagtatgaagccgatggcatc
tccgagaaatcctatgctgaactagaagctgctggctatagtcgtgcctttgtggactca
tacatctcaggtcaggaagctctggtagaccagtacgtcaatcaggtagttgcctttgct
ggtggtcaggagcgctttagtgcaatccatactcacctcgaagcgacaaaccctgctgct
gctgagtcccttgagtctgccatgatgaaccgagacttggcgaccgtcaaagcgattatc
aatctggctggtgagagctacacgaagaaattcggtaagcctgccaaccgtagtgttacc
aagcgtgctactccggttaaacccgtagctcgtcagaaagagggctttacgaatcaggct
gagatgattaaagctatgagcgacccgcgctatcgtagcgattctgcctaccgccaaatg
gtagaacagaaggttatcgactctagtttctaa

DBGET integrated database retrieval system