KEGG   Viruses: 929290Help
Entry
929290            CDS       T40000                                 

Gene name
repA, WDVgp4
Definition
(RefSeq) Wheat dwarf virus; Replication-associated protein A
Taxonomy
TAX:10834 [GN:T40178]
  Lineage
Viruses; ssDNA viruses; Geminiviridae; Mastrevirus
Taxonomy
Organism
vg  Viruses
SSDB OrthologParalogGFIT
Motif
Pfam: Gemini_AL1 Gemini_AL1_M UDPG_MGDP_dh_N Peptidase_C70
Motif
Other DBs
NCBI-GeneID: 929290
NCBI-ProteinID: NP_542350
RS: NC_003326
UniProt: Q8UYK9
Position
NC_003326:complement(1717..2511)
AA seq 264 aa AA seqDB search
MASSSAPRFRVYSKYLFLTYPQCTLEPQYALDSLRTLLNKYEPLYIAAVRELHEDGSPHL
HVLVQNKLRASITNPNALNLRMDTSPFSIFHPNIQAAKDCNQVRDYITKEVDSDANTAEW
GTFVAVSTPGRKDRDADMKQIIESSSSREEFLSMVCNRFPFEWSIRLKDFEYTARHLFPD
PVATYTPEFPTESLICHETIESWKNEHLYSVSLESYIICTSTPADQAQSDLEWMDDYSRS
HRGGISPSTSAGQPEQERLPGQGL
NT seq 795 nt NT seq  +upstreamnt  +downstreamnt
atggcctcttcatctgcacccaggttccgtgtctattccaagtacctctttctaacatat
cctcaatgtacccttgagccacagtacgccttggattcacttcgcactctcttgaacaaa
tatgagcccctctacatcgctgctgttagagagctccacgaagatggatcaccacatctg
cacgttctcgtgcagaacaagcttcgtgcttccatcaccaatcccaatgccttaaacctc
cgtatggatacatctccattctccatattccatccaaatatacaagctgccaaagactgc
aaccaagttcgtgattacatcacgaaggaggttgactccgatgcaaacacagctgagtgg
ggaacattcgtggcagtttcaactccaggtcgtaaagaccgtgatgcggatatgaaacag
atcattgaatctagttcctctcgcgaggaattcctcagcatggtttgcaatcgttttccg
tttgaatggtctatccgtctcaaagacttcgagtacacggcacgccatctatttcctgac
ccagttgccacttacacacctgagtttccaaccgaatcactcatttgccatgagaccatt
gaaagctggaaaaatgaacatctctactccgtaagcctcgaatcctatatcatttgtact
tccactcctgcggatcaagcgcaatctgacttagagtggatggacgattattccaggagt
caccggggaggcataagtccatctacatctgcgggccaaccagaacaggaaagacttcct
gggcaaggtctctag

DBGET integrated database retrieval system