KEGG   Viruses: 932533
Entry
932533            CDS       T40000                                 

Gene name
CamMLVgp077
Definition
(RefSeq) Camelpox virus; Hypothetical protein
Taxonomy
TAX:28873
  Lineage
Viruses; dsDNA viruses; Poxviridae; Chordopoxvirinae; Orthopoxvirus
Organism
vg  Viruses (Camelpox virus)
SSDB
Motif
Pfam: Chordopox_G3 LCCL
Other DBs
NCBI-GeneID: 932533
NCBI-ProteinID: NP_570467
RS: NC_003391
UniProt: Q77FQ6
Position
NC_003391:complement(73593..73928)
AA seq 111 aa
MASLLYLILFLLFVCISYYFTYYPTNKLQAAVMETDRENAIIRQRNDEIPTRTLDTAIFT
DASTVASAQIHLYYNSNIGKIIMSLNGKKHTFNLYDDNDIRTLLPILLLSK
NT seq 336 nt   +upstreamnt  +downstreamnt
atggcatctttattatatcttattttatttttgttattcgtatgtatttcttattatttt
acatattatccgaccaataaacttcaggcagctgtaatggaaacagatagagaaaacgct
attattagacagcgaaatgatgaaataccgactagaacattagatacagctatatttaca
gatgcatcaaccgtcgcgagtgcgcaaatacacctatattataattccaatattggcaaa
attataatgtcacttaatggtaaaaaacacacctttaatttatacgatgataacgacata
cgaacattacttcctattttactccttagtaaatga

DBGET integrated database retrieval system