KEGG   Viruses: 940474Help
Entry
940474            CDS       T40000                                 

Gene name
SSVgp1
Definition
(RefSeq) Sugarcane streak virus; movement protein
Taxonomy
TAX:10836
  Lineage
Viruses; ssDNA viruses; Geminiviridae; Mastrevirus
Taxonomy
Organism
vg  Viruses (Sugarcane streak virus)
SSDB OrthologParalogGFIT
Motif
Pfam: Gemini_mov
Motif
Other DBs
NCBI-GeneID: 940474
NCBI-ProteinID: NP_620490
RS: NC_003744
UniProt: Q89448
Position
NC_003744:1..330
AA seq 109 aa AA seqDB search
MDSFGRAPPLWPQSALPRVPGAAPSSSGLPWSRVGEIAIFTFVAVLALYLLWSWVGRDLL
LVLKARRGGTTEELTFGPRERHSLPAVAVARVENPPCPSGSVEARPFTG
NT seq 330 nt NT seq  +upstreamnt  +downstreamnt
atggatagctttggcagagctcctcctctttggccgcagtcagctttgcctcgggtccct
ggtgctgctccgtcgtcctctggactgccgtggagccgcgtcggtgagatagctatcttt
acctttgttgcagtattggcgctttacctgctctggagttgggtgggtagagatcttctc
ttggttcttaaggctcgccgcggaggcactacggaggagctgacatttgggcccagggag
cgccacagtttaccagctgtagctgttgctcgggtggaaaatcctccgtgtcccagtggt
tcagtggaagctagaccgttcaccggttag

DBGET integrated database retrieval system