KEGG   Viruses: 944351Help
Entry
944351            CDS       T40000                                 

Gene name
SpV1-C74p06
Definition
(RefSeq) Spiroplasma phage 1-C74; putative transposase
Taxonomy
TAX:185959
  Lineage
Viruses; ssDNA viruses; Inoviridae; Vespertiliovirus; Spiroplasma virus C74
Taxonomy
Organism
vg  Viruses (Spiroplasma virus C74)
SSDB OrthologParalogGFIT
Motif
Pfam: rve rve_3 DDE_Tnp_IS240 PulA_N1
Motif
Other DBs
NCBI-GeneID: 944351
NCBI-ProteinID: NP_620626
RS: NC_003793
UniProt: Q88419
Position
NC_003793:3812..4900
AA seq 362 aa AA seqDB search
MKYIINNFNLFDLQAKLKNFLSKNYKNKYYKRIKQKIFSYINLCNDYYNGNFLLKDLIKK
YFKNKFSTFYYWANKILIAYKSNDFAELLLKSTIPNNINYQYSNDVRQNICDLYFKYCNK
HAGGVLSLFYNLKKGIHGEELKNKAPKNLKTFFRWLKKDERWLKIKNKIKEIKKQHSRYE
VKEIGLLQMDAKYFVPSKFSVDKKYYVYDFIDEKTRLALGYVYDKLSTDNAIDAVKKAIS
DFKNIFGIIITRIRTDNGSEFINNYRNNQKISVKKTNFTQFLTDKNILHQTTPVRSPQSN
GKIERFHQNYTKLFVFEEKILNAVSLQNKLNDYYYFYNFERVHKSLNFQTPFNFLNSLSL
IK
NT seq 1089 nt NT seq  +upstreamnt  +downstreamnt
atgaaatatattattaataattttaatttgtttgatttacaagcaaaattaaagaatttt
ttaagtaaaaattataaaaataaatattataaaagaataaaacaaaaaatattttcatat
attaatttgtgtaatgattattataatggtaattttttgttgaaagatttaattaaaaaa
tattttaaaaataagttttcaactttttattattgagcgaataaaattttaattgcatat
aaaagtaatgattttgctgaattattattaaagtcaacaattcctaataatattaattat
caatatagtaatgatgttcgtcaaaatatttgtgatttatattttaaatattgtaataaa
catgctgggggtgttttatctttgttttataatttaaaaaaaggaattcacggagaagaa
ttaaaaaataaagcgccaaaaaatttgaaaacattttttcgttgacttaaaaaagatgaa
agatgattaaaaataaaaaataaaattaaagaaattaaaaaacaacattcaagatatgaa
gttaaagaaataggtttgttacagatggacgctaaatattttgtaccaagtaaattttca
gttgataaaaagtattatgtttatgattttattgatgaaaaaacaagattagcattagga
tatgtttatgataaattaagtactgataatgctattgatgctgttaaaaaagcaattagt
gattttaaaaatatatttggtattataataacacggattagaactgataacggttctgaa
tttattaataattatcgtaataatcaaaaaattagtgttaaaaagactaattttactcaa
tttttaacagataaaaatattttgcatcaaacaacaccagttcgctctccacagtcaaac
ggtaagattgaaagatttcatcaaaattatactaaattatttgtatttgaagaaaaaata
ttaaatgcagttagtttacagaataaattaaatgattattattatttttataattttgaa
agagtacataagtctttaaattttcagacaccatttaattttttgaatagtttaagttta
attaaataa

DBGET integrated database retrieval system