KEGG   Viruses: 944478Help
Entry
944478            CDS       T40000                                 

Gene name
Clbvgp1
Definition
(RefSeq) Citrus leaf blotch virus; replicase polyprotein
Taxonomy
TAX:129141
  Lineage
Viruses; ssRNA viruses; Tymovirales; Betaflexiviridae; Trivirinae; Citrivirus
Taxonomy
Organism
vg  Viruses (Citrus leaf blotch virus)
SSDB OrthologParalogGFIT
Motif
Pfam: Vmethyltransf RdRP_2 Peptidase_C23 Viral_helicase1 2OG-FeII_Oxy_2 Peptidase_C34 2OG-FeII_Oxy AAA_22 AAA_30 UvrD_C_2
Motif
Other DBs
NCBI-GeneID: 944478
NCBI-ProteinID: NP_624333
RS: NC_003877
UniProt: Q91QZ3
Position
NC_003877:74..5962
AA seq 1962 aa AA seqDB search
MALMSNKTAIESILGNFEKKHVDAIYNAAAQTILSHSEFRNKHFAYSLNSYQKKIASKVG
IELYPNGYLPHSHPLSKIFENHLLFDVLPGVVNTSRLVMCSIKESKVLVFKGIRDKSRRQ
VSDLNALNSLNNSHTSFINRLVASKDVSRYTEEADAFFQSKKGSPELFSRNFIKSLENKE
AVFFHDEVHHWTKAQMFSFLKSTKVKRFIFTVVYPPEILKKFANSQNPKVYDFKVDKGRL
FFFPDGVKTEAYEQKLNMEWLFSASHLRSGDCVWTVTRHKSIYAHHLFEISIGELVTDSK
LFFSDYNSIDMSKIFLDRFRSYEVFPISIEHLYKVYSYLLCLKKPDLESGLAKLRQIIGD
DVEIKEFLFFEQFCKRLIERQTSWGLFGHSFFEKLTDMALSSLPNSIARIFPQWKKKNTF
EFLFSLGTLVVDVERKVCFEHVLEEWGFEVVITDENAYLDPLSIFAINENFNEDRVDDGY
LERIRLPFWNLNDYDLKRKRVNAYNILSYRFEEERKIESAQKGPNKMLQIEWYGIKEFKV
DPFISNSITEFTLLEALLGKRIDPKKYSYSKQACTLSNYLTFLCAEGLDGFNLEEHLERR
LKAAGHDVSDDEEEELTSAEQAGPIKILADPLGFMKECLEEIPIETEPSLEERGQFSTDY
HSEKFEINYNDIFNPHNCMNTHGDEIPTPSDGNCFFSAFTETFEVERPDTLRSDFSDWLM
EFNGGSYASLAEMIRPNGVFMEAELIYLFCVFRGVTLIIHDRTHEKENVYAVHRGFEEGH
MVHRGNHFVGIETYNISTLTSDPLLGDIPCGFSEEITKFHFRPDHFNCAQFRGRKAAFIT
KVDADYGHNGMVYPHNSWVPSLEEIIQICGQGDDFNCALINFYEANSSLGFHRDNERVYN
DDPILTVCTFGEGRFTIEFKDQVTSFLMTAGSFFLMPKGFQKKARHSVSNEMSRVSITFR
KHVRRLNGSPIAIREENYKNTCLINAFSKAMKRSKQAIIAKLKTVNSPFWSRYLSEGNGG
SIEDCQSACEALDVTVDLNVNGKCVVLGKGALRISMALRNNHFSVINAAQLMERTFVSHL
LEKGNVNVLEGFDAMLSGDVGAAGVNKIQFAANFEFARILANSFLNMTTGICLGKALDNG
EKYFLHILKDRVKQIGIDVTMVCGFAGSGKSRKLQSWLHSRKKGNFCVVSPRTNLAADWA
FKLELEPNEQRKVSTFEKFIKTDKSKLDLIVIDELTLFPNGYLDLLVYELADVNRHCQII
LLFDPLQARYHNKMDESILTFEHDVDRLIGGQNIEYIYSTHRMSRYFNRFFDVPCFNQAD
RTEEQRLWIFDDVYSIPSICSDRQEPCDVLLVESDLEKKAFSPIINVMTFGESQGLTFNH
VCILLSESSAASNEFRWMVALTRARTRFSLCSTFLGGIEEFKVKRKESLITSILQGEKIT
FNRLNLMLKCNLIRREKENGCRDEVDREERLEGDPFLKPFIFLGQRVEKDEDEVEEVKIR
EPTCQTHLYITEPNFGLCYNFDFIREKEQREYREDMLVTNQFCDSYDKVHINGKRETPGP
LRFKAIYPKHSADDDMTFWMAVRKRLVFREEEENYQRLSRAHLVGGLLYTNFKKKMGLEF
TFDQGLLEESINAFEKKKLEKSCGTIKSHSIRSDIDWALNDVFLFMKSQLCTKYEKQFVD
AKAGQTLACFQHLILVQFAPWCRYLETQIRNQLPEEIYIHSNKNFDDLNAWVKKFFQRDI
CVESDYEAFDASQDEYILSFEIHLMKDAHFPQKIIDAYIDLKCKLGCKLGHFSIMRFTGE
FCTFLFNTLANMAFTMCRYEWRRGQPIAFAGDDMCALNNLAVCHDFDDLFELISLKAKVE
RTETPMFCGWRLTPYGIVKEPELVYNRFQVAIEEGKVLECLENYAIEVSYAYSLSERLYE
VLKSERQVQYHQAVVRFIVTHIDKLKTKVRDLFLEQSSDEDI
NT seq 5889 nt NT seq  +upstreamnt  +downstreamnt
atggctttgatgagcaacaaaactgcaattgaatctattttgggtaactttgaaaagaaa
cacgtcgatgcaatctacaatgccgccgcacaaactatcctctctcactctgaatttagg
aataagcattttgcttattcactcaattcttatcaaaagaagatagcctcaaaggtgggt
attgaattgtatccaaatggttatttaccacattcccatccattgtcaaaaatttttgag
aaccatttgctttttgatgtacttcctggcgtagtaaatactagtagattagttatgtgt
agcataaaggagtccaaagttctggtttttaaagggattcgcgacaaatccagaagacag
gtttcagacctcaatgccctcaattccttaaataatagtcatacatcattcattaatagg
ttagttgcatccaaagatgtgagtagatatacggaagaagctgatgctttttttcaatcc
aagaaagggagtccggagctattttcaaggaatttcatcaaaagcttggaaaataaagag
gctgttttttttcatgatgaagttcatcactggactaaggcccaaatgttctcatttctt
aaaagcacgaaggtcaaaaggttcattttcactgtagtctatccaccagaaattctcaaa
aaatttgccaattcccagaacccaaaggtttatgatttcaaagttgataagggtcggctt
tttttttttccggatggggttaagacagaggcctatgagcagaaattgaatatggagtgg
ctcttttcagcatcacatcttcgcagtggagactgtgtatggactgtaacaagacataag
agtatttatgctcatcacctgtttgagatatccattggcgaactagtcacggactcaaaa
ctttttttttccgattataactccattgacatgtctaaaatatttcttgatcgttttcgg
agttatgaggtattccccatttcgattgagcacctttataaggtctactcttatctgctt
tgcctcaaaaaacctgacttggagagtggtctagctaaattaaggcaaattattggagat
gatgtcgaaatcaaagaattcctcttctttgaacaattttgtaagcgcttaattgaacgc
caaacctcttgggggctatttgggcactctttctttgaaaaattaaccgatatggcattg
tcatccttgcccaactctatagcccgaatttttcctcaatggaaaaaaaaaaacacattt
gagttccttttctcacttgggactcttgttgtggatgtggagagaaaggtgtgttttgaa
catgtgcttgaggaatggggatttgaagttgttatcactgatgaaaatgcctatcttgat
ccactatctatctttgctatcaatgaaaattttaatgaggatagagtggacgatggttat
ttggaaagaatccgtcttcccttctggaatctgaatgactatgacttgaaaagaaagagg
gtaaatgcgtataacattctctcttatcgatttgaagaggagcgaaaaattgaatcagcg
caaaaaggtccaaataagatgctccagattgagtggtacgggattaaagaatttaaagtt
gacccttttatcagcaactccataactgaatttactcttttagaagcattgctgggaaag
aggatagatccaaaaaaatactcatattcaaagcaagcctgcactctttccaactatctc
acatttttgtgtgctgagggtttggatggattcaatttggaagagcaccttgaacgaagg
ttgaaagcggccggtcatgacgtttcagatgacgaggaggaagaattgacttcagctgaa
caagcggggcctatcaagatattggctgatccacttggttttatgaaagagtgtttggag
gagatcccaatcgaaactgaaccatcactggaagaaagagggcagttttccactgattat
cattctgagaaatttgaaatcaattacaatgacatttttaatcctcacaattgcatgaac
actcacggcgatgaaattcccacaccgtcagatggcaattgttttttttcagcatttact
gaaacttttgaagttgaaagacctgacaccttgaggtctgatttctcagactggcttatg
gaatttaatggggggtcctatgcttcacttgcagaaatgatcagaccgaatggagttttt
atggaggcagaactcatatacttgttttgtgtatttagaggagtcacgttgattattcat
gatagaactcatgaaaaagagaatgtttatgctgtacaccgcgggtttgaggagggccat
atggtacatagaggcaatcattttgtcgggattgaaacttacaatattagtactttaacc
tcagaccccttacttggtgacatcccatgcggtttttcagaggaaattacaaaattccat
tttcggcctgatcatttcaactgtgcccagttcagaggaaggaaggcggcttttatcacc
aaagttgatgcagattacgggcacaacggtatggtttacccccacaattcatgggtacct
tctttagaagagatcattcagatctgtggtcagggagatgatttcaattgtgcattaata
aatttctatgaggcaaactcatctcttgggttccatagggataatgaacgggtgtacaat
gatgatcctattttgaccgtctgcacattcggtgaaggtagattcaccattgaatttaag
gatcaggtaacttcttttctaatgactgctggctctttctttttaatgcctaaagggttc
cagaagaaggcaagacactctgtctcaaatgaaatgtcgagagtctcgattactttcagg
aagcatgttagaaggttgaatgggtcaccgattgccatcagggaagaaaattacaaaaat
acatgcctcattaatgccttttcaaaagcaatgaaaaggagcaaacaggcaatcattgca
aaactgaagactgttaatagccctttctggagtagatacctatctgagggtaacggtggc
tccattgaagattgtcaatcggcctgtgaggcactggatgttactgtcgaccttaatgta
aatggaaaatgtgtggttcttggaaaaggggctttaagaatctcaatggctttaagaaac
aaccatttttcagttatcaatgctgcacaactgatggagaggacttttgttagccacttg
cttgaaaaaggaaatgtcaatgtgttagaaggatttgacgcaatgctaagtggtgatgtg
ggcgcagcaggtgttaacaaaattcaatttgcagccaattttgaatttgctagaattttg
gcaaattcatttctaaatatgacaactggcatctgcctgggcaaggcattggataatggg
gaaaagtattttctccacattttgaaagatagagtgaaacagattggtatagacgtcaca
atggtgtgcggatttgctggatcggggaaaagtcgcaaactgcagtcctggctgcattca
aggaaaaaagggaacttctgtgtggtttccccaagaacaaacttagccgctgactgggca
ttcaagttagaattagagcccaatgaacagagaaaggtttcaacatttgaaaaattcatc
aaaactgataaaagcaaattagatctcatagttattgatgaattgacattgtttccaaat
ggttacctggatctcctcgtgtatgaattggctgatgtcaataggcattgtcaaatcatc
cttctgtttgatccattgcaagcaagataccacaacaaaatggatgaatcaatcctgaca
tttgaacatgacgtggacaggcttattggtggacagaacattgagtacatttacagcacg
catcggatgtccagatacttcaatagattttttgatgtaccttgcttcaatcaggctgat
agaacagaggaacaaaggttgtggatatttgatgacgtttactccataccatccatttgc
tccgaccgtcaggaaccatgtgatgttcttttggttgaatctgaccttgaaaagaaggca
ttttcacccatcataaatgttatgacatttggtgaatcccagggactcacatttaatcat
gtttgtattttgctgtcagagtccagtgcagcttcaaacgaatttagatggatggtggcg
ctgacgagagcaaggaccaggttttcactctgttcaaccttcttaggtggaattgaagaa
tttaaagtcaaaaggaaggaaagtctcatcacatccatactccaaggcgagaagatcaca
ttcaacagattaaatctgatgctgaaatgcaatttaattaggagagaaaaagaaaatggg
tgcagagatgaggtcgatagggaggaaaggttggagggtgaccctttcctcaaaccattt
atcttcttgggacaaagagttgagaaggatgaagatgaggtagaagaagtgaagatcagg
gaaccaacctgtcaaactcatctgtatataacagagcctaattttggtttgtgctacaat
ttcgacttcattagggaaaaagaacagcgggaatacagagaggatatgcttgtaactaac
caattctgtgacagttatgataaggttcatataaacggcaaaagagaaacccctggtccc
ctgcgattcaaagcgatttatccaaagcactcagccgatgatgacatgacgttctggatg
gccgtcagaaaaaggcttgtatttagagaagaggaggagaattatcaaaggttgtcaagg
gcgcatttagttgggggtttgctatacaccaacttcaaaaaaaaaatgggcctggaattt
acgtttgaccaaggtctactggaggaaagcataaatgcatttgaaaagaaaaagctggaa
aaatcatgtggcacaattaaatctcatagcataaggtcggacattgattgggcgctgaat
gatgtatttcttttcatgaaaagccagttatgcaccaagtacgaaaaacaatttgttgat
gctaaagcgggtcaaactcttgcctgttttcagcacctgattttggtacagttcgctcca
tggtgtagatacctagaaacccagatcagaaatcagttgcctgaagaaatttacattcac
tcaaataaaaattttgatgatttgaatgcatgggtcaaaaaatttttccagagggatatc
tgtgttgagtctgattatgaagcatttgatgcaagccaggatgaatacatattatccttc
gagattcatctgatgaaagatgcgcattttccgcagaaaatcattgatgcatacatagac
cttaaatgcaaattgggatgcaaattgggccatttttcaataatgagatttacaggggaa
ttttgcaccttcctattcaacacactggccaatatggcattcactatgtgtagatacgaa
tggaggagaggacaaccaattgcattcgcaggagatgatatgtgtgcattaaacaatttg
gctgtttgtcatgatttcgatgacctttttgaactcatcagcctaaaagctaaggtggaa
aggacagaaaccccaatgttttgtggatggagactaactccatatgggattgtgaaggag
cctgaattagtctataatcgctttcaagtggccattgaagagggaaaggtcttggagtgt
ctggaaaattatgcaatcgaggtttcttatgcctacagtttaagtgagaggctgtatgaa
gttttgaaaagtgaaaggcaagttcagtatcatcaagctgtggttagatttatagtcacg
cacattgacaaactcaaaacaaaagtgagggaccttttcttagaacaatcttccgacgaa
gatatctga

DBGET integrated database retrieval system