KEGG   Viruses: 951560
Entry
951560            CDS       T40000                                 

Gene name
EVM055, ECTVgp055
Definition
(RefSeq) Ectromelia virus; IMV membrane protein
Taxonomy
TAX:12643
  Lineage
Viruses; dsDNA viruses; Poxviridae; Chordopoxvirinae; Orthopoxvirus
Organism
vg  Viruses (Ectromelia virus)
SSDB
Motif
Pfam: Pox_EPC_I2-L1 CoV_S2 vMSA DUF3671 DUF2207 ATG27 zf-LITAF-like DUF5542
Other DBs
NCBI-GeneID: 951560
NCBI-ProteinID: NP_671573
RS: NC_004105
UniProt: Q77ZD0
Position
NC_004105:complement(69617..69838)
AA seq 73 aa
MDKLYAAIFGVFMGSPEDDLTDFIEIVKSVLSDEKTVTSTNNTGCWGWYWLIIIFFIVLI
LLLLIYLYLKVVW
NT seq 222 nt   +upstreamnt  +downstreamnt
atggataagttgtacgctgctatatttggtgtatttatgggttctccggaagatgatttg
acagactttatagaaattgttaaatctgttctaagtgacgagaaaactgtcacatcaact
aataataccggttgttggggttggtattggttaattattattttttttatagttcttatt
ctactactattgatatatttgtatttaaaagttgtttggtga

DBGET integrated database retrieval system