KEGG   Viruses: 951655
Entry
951655            CDS       T40000                                 

Gene name
EVM050, ECTVgp050
Definition
(RefSeq) Ectromelia virus; sulfhydryl oxidase
Taxonomy
TAX:12643
  Lineage
Viruses; dsDNA viruses; Poxviridae; Chordopoxvirinae; Orthopoxvirus
Organism
vg  Viruses (Ectromelia virus)
SSDB
Motif
Pfam: Pox_E10 Evr1_Alr
Other DBs
NCBI-GeneID: 951655
NCBI-ProteinID: NP_671568
RS: NC_004105
UniProt: Q77ZD1
Position
NC_004105:65500..65787
AA seq 95 aa
MNPKHWGRAVWTIIFIVLSQAGLDGNIEACKRKLYTIVSTLPCPACRRHATIAIEDNNVM
SSDDLNYIYYFFIRLFNNLASDPKYAIDVTKVNPL
NT seq 288 nt   +upstreamnt  +downstreamnt
atgaatcccaaacattggggaagagccgtatggactattatttttatagtactttctcaa
gcgggtttagatggcaacatagaagcgtgtaaaagaaaactatatactatagtcagcact
cttccatgtcctgcatgtagacgacacgcaactatcgctatagaggacaataatgtcatg
tctagcgatgatctgaattatatttattattttttcatcagattatttaacaatttggca
tctgatcccaaatacgcgatcgatgtgacaaaggttaaccctttataa

DBGET integrated database retrieval system