KEGG   Viruses: 956529Help
Entry
956529            CDS       T40000                                 

Gene name
HA, FLUAVs4gp1
Definition
(RefSeq) Influenza A virus (A/Puerto Rico/8/1934(H1N1)); haemagglutinin
  KO
K19251  Influenza A virus hemagglutinin
Taxonomy
TAX:211044 [GN:T40035]
  Lineage
Viruses; ssRNA viruses; Negarnaviricota; Polyploviricotina; Insthoviricetes; Articulavirales; Orthomyxoviridae; Alphainfluenzavirus; Influenza A virus; H1N1 subtype
Taxonomy
Organism
vg  Viruses (Influenza A virus)
SSDB OrthologParalogGFIT
Motif
Pfam: Hemagglutinin EzrA
Motif
Other DBs
NCBI-GeneID: 956529
NCBI-ProteinID: NP_040980
RS: NC_002017
UniProt: P03452
Structure
PDB: 

Position
NC_002017:33..1733
AA seq 566 aa AA seqDB search
MKANLLVLLCALAAADADTICIGYHANNSTDTVDTVLEKNVTVTHSVNLLEDSHNGKLCR
LKGIAPLQLGKCNIAGWLLGNPECDPLLPVRSWSYIVETPNSENGICYPGDFIDYEELRE
QLSSVSSFERFEIFPKESSWPNHNTTKGVTAACSHAGKSSFYRNLLWLTEKEGSYPKLKN
SYVNKKGKEVLVLWGIHHPSNSKDQQNIYQNENAYVSVVTSNYNRRFTPEIAERPKVRDQ
AGRMNYYWTLLKPGDTIIFEANGNLIAPRYAFALSRGFGSGIITSNASMHECNTKCQTPL
GAINSSLPFQNIHPVTIGECPKYVRSAKLRMVTGLRNIPSIQSRGLFGAIAGFIEGGWTG
MIDGWYGYHHQNEQGSGYAADQKSTQNAINGITNKVNSVIEKMNIQFTAVGKEFNKLEKR
MENLNKKVDDGFLDIWTYNAELLVLLENERTLDFHDSNVKNLYEKVKSQLKNNAKEIGNG
CFEFYHKCDNECMESVRNGTYDYPKYSEESKLNREKVDGVKLESMGIYQILAIYSTVASS
LVLLVSLGAISFWMCSNGSLQCRICI
NT seq 1701 nt NT seq  +upstreamnt  +downstreamnt
atgaaggcaaacctactggtcctgttatgtgcacttgcagctgcagatgcagacacaata
tgtataggctaccatgcgaacaattcaaccgacactgttgacacagtgctcgagaagaat
gtgacagtgacacactctgttaacctgctcgaagacagccacaacggaaaactatgtaga
ttaaaaggaatagccccactacaattggggaaatgtaacatcgccggatggctcttggga
aacccagaatgcgacccactgcttccagtgagatcatggtcctacattgtagaaacacca
aactctgagaatggaatatgttatccaggagatttcatcgactatgaggagctgagggag
caattgagctcagtgtcatcattcgaaagattcgaaatatttcccaaagaaagctcatgg
cccaaccacaacacaaccaaaggagtaacggcagcatgctcccatgcggggaaaagcagt
ttttacagaaatttgctatggctgacggagaaggagggctcatacccaaagctgaaaaat
tcttatgtgaacaagaaagggaaagaagtccttgtactgtggggtattcatcacccgtct
aacagtaaggatcaacagaatatctatcagaatgaaaatgcttatgtctctgtagtgact
tcaaattataacaggagatttaccccggaaatagcagaaagacccaaagtaagagatcaa
gctgggaggatgaactattactggaccttgctaaaacccggagacacaataatatttgag
gcaaatggaaatctaatagcaccaaggtatgctttcgcactgagtagaggctttgggtcc
ggcatcatcacctcaaacgcatcaatgcatgagtgtaacacgaagtgtcaaacacccctg
ggagctataaacagcagtctccctttccagaatatacacccagtcacaataggagagtgc
ccaaaatacgtcaggagtgccaaattgaggatggttacaggactaaggaacattccgtcc
attcaatccagaggtctatttggagccattgccggttttattgaagggggatggactgga
atgatagatggatggtacggttatcatcatcagaatgaacagggatcaggctatgcagcg
gatcaaaaaagcacacaaaatgccattaacgggattacaaacaaggtgaactctgttatc
gagaaaatgaacattcaattcacagctgtgggtaaagaattcaacaaattagaaaaaagg
atggaaaatttaaataaaaaagttgatgatggatttctggacatttggacatataatgca
gaattgttagttctactggaaaatgaaaggactctggatttccatgactcaaatgtgaag
aatctgtatgagaaagtaaaaagccaattaaagaataatgccaaagaaatcggaaatgga
tgttttgagttctaccacaagtgtgacaatgaatgcatggaaagtgtaagaaatgggact
tatgattatcccaaatattcagaagagtcaaagttgaacagggaaaaggtagatggagtg
aaattggaatcaatggggatctatcagattctggcgatctactcaactgtcgccagttca
ctggtgcttttggtctccctgggggcaatcagtttctggatgtgttctaatggatctttg
cagtgcagaatatgcatctga

DBGET integrated database retrieval system