KEGG   Viruses: 956530Help
Entry
956530            CDS       T40000                                 

Gene name
NA, FLUAVs6gp1
Definition
(RefSeq) Influenza A virus (A/Puerto Rico/8/1934(H1N1)); neuraminidase
  KO
K19392  Influenza A virus neuraminidase [EC:3.2.1.18]
Taxonomy
TAX:211044 [GN:T40035]
  Lineage
Viruses; ssRNA viruses; Negarnaviricota; Polyploviricotina; Insthoviricetes; Articulavirales; Orthomyxoviridae; Alphainfluenzavirus; Influenza A virus; H1N1 subtype
Taxonomy
Organism
vg  Viruses (Influenza A virus)
SSDB OrthologParalogGFIT
Motif
Pfam: Neur
Motif
Other DBs
NCBI-GeneID: 956530
NCBI-ProteinID: NP_040981
RS: NC_002018
UniProt: P03468
Position
NC_002018:21..1385
AA seq 454 aa AA seqDB search
MNPNQKIITIGSICLVVGLISLILQIGNIISIWISHSIQTGSQNHTGICNQNIITYKNST
WVKDTTSVILTGNSSLCPIRGWAIYSKDNSIRIGSKGDVFVIREPFISCSHLECRTFFLT
QGALLNDRHSNGTVKDRSPYRALMSCPVGEAPSPYNSRFESVAWSASACHDGMGWLTIGI
SGPDNGAVAVLKYNGIITETIKSWRKKILRTQESECACVNGSCFTIMTDGPSDGLASYKI
FKIEKGKVTKSIELNAPNSHYEECSCYPDTGKVMCVCRDNWHGSNRPWVSFDQNLDYQIG
YICSGVFGDNPRPKDGTGSCGPVYVDGANGVKGFSYRYGNGVWIGRTKSHSSRHGFEMIW
DPNGWTETDSKFSVRQDVVAMTDWSGYSGSFVQHPELTGLDCIRPCFWVELIRGRPKEKT
IWTSASSISFCGVNSDTVDWSWPDGAELPFTIDK
NT seq 1365 nt NT seq  +upstreamnt  +downstreamnt
atgaatccaaatcagaaaataataaccattggatcaatctgtctggtagtcggactaatt
agcctaatattgcaaatagggaatataatctcaatatggattagccattcaattcaaact
ggaagtcaaaaccatactggaatatgcaaccaaaacatcattacctataaaaatagcacc
tgggtaaaggacacaacttcagtgatattaaccggcaattcatctctttgtcccatccgt
gggtgggctatatacagcaaagacaatagcataagaattggttccaaaggagacgttttt
gtcataagagagccctttatttcatgttctcacttggaatgcaggaccttttttctgacc
caaggtgccttactgaatgacaggcattcaaatgggactgttaaggacagaagcccttat
agggccttaatgagctgccctgtcggtgaagctccgtccccgtacaattcaagatttgaa
tcggttgcttggtcagcaagtgcatgtcatgatggcatgggctggctaacaatcggaatt
tcaggtccagataatggagcagtggctgtattaaaatacaacggcataataactgaaacc
ataaaaagttggaggaagaaaatattgaggacacaagagtctgaatgtgcctgtgtaaat
ggttcatgttttactataatgactgatggcccgagtgatgggctggcctcgtacaaaatt
ttcaagatcgaaaaggggaaggttactaaatcaatagagttgaatgcacctaattctcac
tatgaggaatgttcctgttaccctgataccggcaaagtgatgtgtgtgtgcagagacaat
tggcatggttcgaaccggccatgggtgtctttcgatcaaaacctggattatcaaatagga
tacatctgcagtggggttttcggtgacaacccgcgtcccaaagatggaacaggcagctgt
ggtccagtgtatgttgatggagcaaacggagtaaagggattttcatataggtatggtaat
ggtgtttggataggaaggaccaaaagtcacagttccagacatgggtttgagatgatttgg
gatcctaatggatggacagagactgatagtaagttctctgtgaggcaagatgttgtggca
atgactgattggtcagggtatagcgggagtttcgttcaacatcctgagctaacagggcta
gactgtataaggccgtgcttctgggttgaattaatcaggggacgacctaaagaaaaaaca
atctggactagtgcgagcagcatttctttttgtggcgtgaatagtgatactgtagattgg
tcttggccagacggtgctgagttgccattcaccattgacaagtag

DBGET integrated database retrieval system