KEGG   Viruses: 956531
Entry
956531            CDS       T40000                                 

Gene name
NP, FLUAVs5gp1
Definition
(RefSeq) Influenza A virus (A/Puerto Rico/8/1934(H1N1)); nucleoprotein
  KO
K19391  Influenza A virus nucleoprotein
Taxonomy
TAX:211044 [GN:T40035]
  Lineage
Viruses; -ssRNA viruses; Riboviria; Orthornavirae; Negarnaviricota; Polyploviricotina; Insthoviricetes; Articulavirales; Orthomyxoviridae; Alphainfluenzavirus; Influenza A virus; H1N1 subtype
Organism
vg  Viruses (Influenza A virus)
SSDB
Motif
Pfam: Flu_NP DUF525
Other DBs
NCBI-GeneID: 956531
NCBI-ProteinID: NP_040982
RS: NC_002019
UniProt: P03466
Structure
PDB: 
2YMN

Position
NC_002019:46..1542
AA seq 498 aa
MASQGTKRSYEQMETDGERQNATEIRASVGKMIGGIGRFYIQMCTELKLSDYEGRLIQNS
LTIERMVLSAFDERRNKYLEEHPSAGKDPKKTGGPIYRRVNGKWMRELILYDKEEIRRIW
RQANNGDDATAGLTHMMIWHSNLNDATYQRTRALVRTGMDPRMCSLMQGSTLPRRSGAAG
AAVKGVGTMVMELVRMIKRGINDRNFWRGENGRKTRIAYERMCNILKGKFQTAAQKAMMD
QVRESRDPGNAEFEDLTFLARSALILRGSVAHKSCLPACVYGPAVASGYDFEREGYSLVG
IDPFRLLQNSQVYSLIRPNENPAHKSQLVWMACHSAAFEDLRVLSFIKGTKVVPRGKLST
RGVQIASNENMETMESSTLELRSRYWAIRTRSGGNTNQQRASAGQISIQPTFSVQRNLPF
DRTTVMAAFTGNTEGRTSDMRTEIIRMMESARPEDVSFQGRGVFELSDEKAASPIVPSFD
MSNEGSYFFGDNAEEYDN
NT seq 1497 nt   +upstreamnt  +downstreamnt
atggcgtcccaaggcaccaaacggtcttacgaacagatggagactgatggagaacgccag
aatgccactgaaatcagagcatccgtcggaaaaatgattggtggaattggacgattctac
atccaaatgtgcacagaacttaaactcagtgattatgagggacggttgatccaaaacagc
ttaacaatagagagaatggtgctctctgcttttgacgaaaggagaaataaatacctggaa
gaacatcccagtgcggggaaggatcctaagaaaactggaggacctatatacagaagagta
aacggaaagtggatgagagaactcatcctttatgacaaagaagaaataaggcgaatctgg
cgccaagctaataatggtgacgatgcaacggctggtctgactcacatgatgatctggcat
tccaatttgaatgatgcaacttatcagaggacaagggctcttgttcgcaccggaatggat
cccaggatgtgctctctgatgcaaggttcaactctccctaggaggtctggagccgcaggt
gctgcagtcaaaggagttggaacaatggtgatggaattggtcaggatgatcaaacgtggg
atcaatgatcggaacttctggaggggtgagaatggacgaaaaacaagaattgcttatgaa
agaatgtgcaacattctcaaagggaaatttcaaactgctgcacaaaaagcaatgatggat
caagtgagagagagccgggacccagggaatgctgagttcgaagatctcacttttctagca
cggtctgcactcatattgagagggtcggttgctcacaagtcctgcctgcctgcctgtgtg
tatggacctgccgtagccagtgggtacgactttgaaagagagggatactctctagtcgga
atagaccctttcagactgcttcaaaacagccaagtgtacagcctaatcagaccaaatgag
aatccagcacacaagagtcaactggtgtggatggcatgccattctgccgcatttgaagat
ctaagagtattgagcttcatcaaagggacgaaggtggtcccaagagggaagctttccact
agaggagttcaaattgcttccaatgaaaatatggagactatggaatcaagtacacttgaa
ctgagaagcaggtactgggccataaggaccagaagtggaggaaacaccaatcaacagagg
gcatctgcgggccaaatcagcatacaacctacgttctcagtacagagaaatctccctttt
gacagaacaaccgttatggcagcattcactgggaatacagaggggagaacatctgacatg
aggaccgaaatcataaggatgatggaaagtgcaagaccagaagatgtgtctttccagggg
cggggagtcttcgagctctcggacgaaaaggcagcgagcccgatcgtgccttcctttgac
atgagtaatgaaggatcttatttcttcggagacaatgcagaggagtacgacaattaa

DBGET integrated database retrieval system