KEGG   Viruses: 956535Help
Entry
956535            CDS       T40000                                 

Gene name
PA, FLUAVs3gp1
Definition
(RefSeq) Influenza A virus (A/Puerto Rico/8/1934(H1N1)); polymerase PA
  KO
K19390  Influenza A virus polymerase acidic protein
Taxonomy
TAX:211044 [GN:T40035]
  Lineage
Viruses; ssRNA viruses; Negarnaviricota; Polyploviricotina; Insthoviricetes; Articulavirales; Orthomyxoviridae; Alphainfluenzavirus; Influenza A virus; H1N1 subtype
Taxonomy
Organism
vg  Viruses (Influenza A virus)
SSDB OrthologParalogGFIT
Motif
Pfam: Flu_PA
Motif
Other DBs
NCBI-GeneID: 956535
NCBI-ProteinID: NP_040986
RS: NC_002022
UniProt: P03433
Structure
PDB: 

Position
NC_002022:25..2175
AA seq 716 aa AA seqDB search
MEDFVRQCFNPMIVELAEKTMKEYGEDLKIETNKFAAICTHLEVCFMYSDFHFINEQGES
IIVELGDPNALLKHRFEIIEGRDRTMAWTVVNSICNTTGAEKPKFLPDLYDYKENRFIEI
GVTRREVHIYYLEKANKIKSEKTHIHIFSFTGEEMATKADYTLDEESRARIKTRLFTIRQ
EMASRGLWDSFRQSERGEETIEERFEITGTMRKLADQSLPPNFSSLENFRAYVDGFEPNG
YIEGKLSQMSKEVNARIEPFLKTTPRPLRLPNGPPCSQRSKFLLMDALKLSIEDPSHEGE
GIPLYDAIKCMRTFFGWKEPNVVKPHEKGINPNYLLSWKQVLAELQDIENEEKIPKTKNM
KKTSQLKWALGENMAPEKVDFDDCKDVGDLKQYDSDEPELRSLASWIQNEFNKACELTDS
SWIELDEIGEDVAPIEHIASMRRNYFTSEVSHCRATEYIMKGVYINTALLNASCAAMDDF
QLIPMISKCRTKEGRRKTNLYGFIIKGRSHLRNDTDVVNFVSMEFSLTDPRLEPHKWEKY
CVLEIGDMLLRSAIGQVSRPMFLYVRTNGTSKIKMKWGMEMRRCLLQSLQQIESMIEAES
SVKEKDMTKEFFENKSETWPIGESPKGVEESSIGKVCRTLLAKSVFNSLYASPQLEGFSA
ESRKLLLIVQALRDNLEPGTFDLGGLYEAIEECLINDPWVLLNASWFNSFLTHALS
NT seq 2151 nt NT seq  +upstreamnt  +downstreamnt
atggaagattttgtgcgacaatgcttcaatccgatgattgtcgagcttgcggaaaaaaca
atgaaagagtatggggaggacctgaaaatcgaaacaaacaaatttgcagcaatatgcact
cacttggaagtatgcttcatgtattcagatttccacttcatcaatgagcaaggcgagtca
ataatcgtagaacttggtgatcctaatgcacttttgaagcacagatttgaaataatcgag
ggaagagatcgcacaatggcctggacagtagtaaacagtatttgcaacactacaggggct
gagaaaccaaagtttctaccagatttgtatgattacaaggaaaatagattcatcgaaatt
ggagtaacaaggagagaagttcacatatactatctggaaaaggccaataaaattaaatct
gagaaaacacacatccacattttctcgttcactggggaagaaatggccacaaaggccgac
tacactctcgatgaagaaagcagggctaggatcaaaaccaggctattcaccataagacaa
gaaatggccagcagaggcctctgggattcctttcgtcagtccgagagaggagaagagaca
attgaagaaaggtttgaaatcacaggaacaatgcgcaagcttgccgaccaaagtctcccg
ccgaacttctccagccttgaaaattttagagcctatgtggatggattcgaaccgaacggc
tacattgagggcaagctgtctcaaatgtccaaagaagtaaatgctagaattgaacctttt
ttgaaaacaacaccacgaccacttagacttccgaatgggcctccctgttctcagcggtcc
aaattcctgctgatggatgccttaaaattaagcattgaggacccaagtcatgaaggagag
ggaataccgctatatgatgcaatcaaatgcatgagaacattctttggatggaaggaaccc
aatgttgttaaaccacacgaaaagggaataaatccaaattatcttctgtcatggaagcaa
gtactggcagaactgcaggacattgagaatgaggagaaaattccaaagactaaaaatatg
aaaaaaacaagtcagctaaagtgggcacttggtgagaacatggcaccagaaaaggtagac
tttgacgactgtaaagatgtaggtgatttgaagcaatatgatagtgatgaaccagaattg
aggtcgcttgcaagttggattcagaatgagttcaacaaggcatgcgaactgacagattca
agctggatagagcttgatgagattggagaagatgtggctccaattgaacacattgcaagc
atgagaaggaattatttcacatcagaggtgtctcactgcagagccacagaatacataatg
aagggggtgtacatcaatactgccttacttaatgcatcttgtgcagcaatggatgatttc
caattaattccaatgataagcaagtgtagaactaaggagggaaggcgaaagaccaacttg
tatggtttcatcataaaaggaagatcccacttaaggaatgacaccgacgtggtaaacttt
gtgagcatggagttttctctcactgacccaagacttgaaccacacaaatgggagaagtac
tgtgttcttgagataggagatatgcttctaagaagtgccataggccaggtttcaaggccc
atgttcttgtatgtgaggacaaatggaacctcaaaaattaaaatgaaatggggaatggag
atgaggcgttgtctcctccagtcacttcaacaaattgagagtatgattgaagctgagtcc
tctgtcaaagagaaagacatgaccaaagagttctttgagaacaaatcagaaacatggccc
attggagagtctcccaaaggagtggaggaaagttccattgggaaggtctgcaggacttta
ttagcaaagtcggtatttaacagcttgtatgcatctccacaactagaaggattttcagct
gaatcaagaaaactgcttcttatcgttcaggctcttagggacaatctggaacctgggacc
tttgatcttggggggctatatgaagcaattgaggagtgcctaattaatgatccctgggtt
ttgcttaatgcttcttggttcaactccttccttacacatgcattgagttag

DBGET integrated database retrieval system