KEGG   Viruses: 956591Help
Entry
956591            CDS       T40000                                 

Gene name
LCMVsSgp1
Definition
(RefSeq) Lymphocytic choriomeningitis mammarenavirus; envelope glycoprotein
Taxonomy
TAX:11623 [GN:T40091]
  Lineage
Viruses; ssRNA viruses; Negarnaviricota; Polyploviricotina; Ellioviricetes; Bunyavirales; Arenaviridae; Mammarenavirus
Taxonomy
Organism
vg  Viruses (Lymphocytic choriomeningitis mammarenavirus)
SSDB OrthologParalogGFIT
Motif
Pfam: Arena_glycoprot
Motif
Other DBs
NCBI-GeneID: 956591
NCBI-ProteinID: NP_694851
RS: NC_004294
UniProt: P09991
Structure
PDB: 

Position
NC_004294:78..1574
AA seq 498 aa AA seqDB search
MGQIVTMFEALPHIIDEVINIVIIVLIVITGIKAVYNFATCGIFALISFLLLAGRSCGMY
GLKGPDIYKGVYQFKSVEFDMSHLNLTMPNACSANNSHHYISMGTSGLELTFTNDSIISH
NFCNLTSAFNKKTFDHTLMSIVSSLHLSIRGNSNYKAVSCDFNNGITIQYNLTFSDRQSA
QSQCRTFRGRVLDMFRTAFGGKYMRSGWGWTGSDGKTTWCSQTSYQYLIIQNRTWENHCT
YAGPFGMSRILLSQEKTKFFTRRLAGTFTWTLSDSSGVENPGGYCLTKWMILAAELKCFG
NTAVAKCNVNHDAEFCDMLRLIDYNKAALSKFKEDVESALHLFKTTVNSLISDQLLMRNH
LRDLMGVPYCNYSKFWYLEHAKTGETSVPKCWLVTNGSYLNETHFSDQIEQEADNMITEM
LRKDYIKRQGSTPLALMDLLMFSTSAYLVSIFLHLVKIPTHRHIKGGSCPKPHRLTNKGI
CSCGAFKVPGVKTVWKRR
NT seq 1497 nt NT seq  +upstreamnt  +downstreamnt
atgggtcagattgtgacaatgtttgaggctctgcctcacatcatcgatgaggtgatcaac
attgtcattattgtgcttatcgtgatcacgggtatcaaggctgtctacaattttgccacc
tgtgggatattcgcattgatcagtttcctacttctggctggcaggtcctgtggcatgtac
ggtcttaagggacccgacatttacaaaggagtttaccaatttaagtcagtggagtttgat
atgtcacatctgaacctgaccatgcccaacgcatgttcagccaacaactcccaccattac
atcagtatggggacttctggactagaattgaccttcaccaatgattccatcatcagtcac
aacttttgcaatctgacctctgccttcaacaaaaagacctttgaccacacactcatgagt
atagtttcgagcctacacctcagtatcagagggaactccaactataaggcagtatcctgc
gacttcaacaatggcataaccatccaatacaacttgacattctcagatcgacaaagtgct
cagagccagtgtagaaccttcagaggtagagtcctagatatgtttagaactgccttcggg
gggaaatacatgaggagtggctggggctggacaggctcagatggcaagaccacctggtgt
agccagacgagttaccaatacctgattatacaaaatagaacctgggaaaaccactgcaca
tatgcaggtccttttgggatgtccaggattctcctttcccaagagaagactaagttcttc
actaggagactagcgggcacattcacctggactttgtcagactcttcaggggtggagaat
ccaggtggttattgcctgaccaaatggatgattcttgctgcagagcttaagtgtttcggg
aacacagcagttgcgaaatgcaatgtaaatcatgatgccgaattctgtgacatgctgcga
ctaattgactacaacaaggctgctttgagtaagttcaaagaggacgtagaatctgccttg
cacttattcaaaacaacagtgaattctttgatttcagatcaactactgatgaggaaccac
ttgagagatctgatgggggtgccatattgcaattactcaaagttttggtacctagaacat
gcaaagaccggcgaaactagtgtccccaagtgctggcttgtcaccaatggttcttactta
aatgagacccacttcagtgatcaaatcgaacaggaagccgataacatgattacagagatg
ttgaggaaggattacataaagaggcaggggagtacccccctagcattgatggaccttctg
atgttttccacatctgcatatctagtcagcatcttcctgcaccttgtcaaaataccaaca
cacaggcacataaaaggtggctcatgtccaaagccacaccgattaaccaacaaaggaatt
tgtagttgtggtgcatttaaggtgcctggtgtaaaaaccgtctggaaaagacgctga

DBGET integrated database retrieval system