KEGG   Viruses: 956653Help
Entry
956653            CDS       T40000                                 

Gene name
BBVs2gp1
Definition
(RefSeq) Black beetle virus; coat protein precursor
Taxonomy
TAX:12285
  Lineage
Viruses; ssRNA viruses; ssRNA positive-strand viruses, no DNA stage; Nodaviridae; Alphanodavirus
Taxonomy
Organism
vg  Viruses (Black beetle virus)
SSDB OrthologParalogGFIT
Motif
Pfam: Peptidase_A6
Motif
Other DBs
NCBI-GeneID: 956653
NCBI-ProteinID: NP_049329
RS: NC_002037
UniProt: P04329
Structure
PDB: 

Position
NC_002037:23..1246
AA seq 407 aa AA seqDB search
MVRNNNRRRQRTQRIVTTTTQTAPVPQQNVPKQPRRRRNRARRNRRQGRAMNMGALTRLS
QPGLAFLKCAFAPPDFNTDPGKGIPDRFEGKVVTRKDVLNQSINFTANRDTFILIAPTPG
VAYWVADVPAGTFPISTTTFNAVNFPGFNSMFGNAAASRSDQVSSFRYASMNVGIYPTSN
LMQFAGSITVWKCPVKLSNVQFPVATTPATSALVHTLVGLDGVLAVGPDNFSESFIKGVF
SQSVCNEPDFEFSDILEGIQTLPPANVTVATSGQPFNLAAGAEAVSGIVGWGNMDTIVIR
VSAPTGAVNSAILKTWACLEYRPNPNAMLYQFGHDSPPCDEVALQEYRTVARSLPVAVIA
AQNASMWERVKSIIKSSLAMASNVPGPIGIAASGLSGLSALFEGFGF
NT seq 1224 nt NT seq  +upstreamnt  +downstreamnt
atggttagaaacaacaaccgaagacgacaacgcacccagcgtatcgtcacaacaacaacc
caaacagcccctgttccgcaacagaatgtcccgaagcagccgaggcgtcgacgcaatcgt
gcgagacgtaataggcgccaggggcgtgcgatgaacatgggggcgctgaccaggcttagt
caacctggtttagcgtttcttaagtgtgcttttgcaccacctgatttcaacaccgatccc
ggtaaaggtattccagacaggtttgaaggcaaagtagtaactcgaaaagatgtactaaac
cagtcgattaactttaccgccaatagggacactttcatcttgatagcccctacgcccggt
gttgcatattgggtcgccgatgttccagctggcacgtttccaatttcaacaactacgttt
aatgccgtgaattttcctggctttaattcgatgtttggtaacgccgctgcatcgcgatcc
gaccaggtatcatcattcaggtatgcttccatgaacgtgggtatataccctacgtcgaac
ttgatgcagtttgccggaagtatcactgtttggaaatgtcctgtaaagctgagcaatgtg
caattcccggttgcaacaacgccggccacctctgcgctagtccacactcttgttggttta
gatggtgttctagcggtgggacctgacaacttctccgaatcctttattaagggtgtgttc
tcacagtctgtttgtaatgagcctgattttgagttctcagatatattggaagggatccaa
accttaccgccagctaacgtcaccgtggctacttcaggccagccttttaaccttgcagct
ggcgctgaagcggtaagtggaatagttggatggggaaacatggacacgatcgtcatccgt
gtctctgcccccacaggcgctgtcaactccgccattcttaagacatgggcatgtcttgag
taccgtcccaatccaaatgccatgttataccaatttggccatgattcgcccccatgtgat
gaggtggcgcttcaagaatatcgtacagtagcccggtctttgccggttgccgtcatagca
gcacaaaatgcatctatgtgggagagggttaaatccattattaaatcctcccttgctatg
gccagcaacgttcccgggcctatcggtatcgcggccagtggtcttagtggtttatccgca
ctctttgaaggtttcgggttttag

DBGET integrated database retrieval system