KEGG   Viruses: 962151
Entry
962151            CDS       T40000                                 

Gene name
CCMVs3gp1
Definition
(RefSeq) Cowpea chlorotic mottle virus; movement protein
Taxonomy
TAX:12303 [GN:T40162]
  Lineage
Viruses; +ssRNA viruses; Riboviria; Orthornavirae; Kitrinoviricota; Alsuviricetes; Martellivirales; Bromoviridae; Bromovirus
Organism
vg  Viruses (Cowpea chlorotic mottle virus)
SSDB
Motif
Pfam: 3A POTRA_2
Other DBs
NCBI-GeneID: 962151
NCBI-ProteinID: NP_613276
RS: NC_003542
UniProt: P20180 Q77JE5
Position
NC_003542:239..1147
AA seq 302 aa
MSNTTFRPFTGSSRTVVEGEQAGAQDDMSLLQSLFSDKSREEFAKECKLGMYTNLSSNNR
LNYIDLVPKNTGSRALNLFKSEYEKGHIPSSGVLSIPRVLVFLVRTTTVTESGSVTIRLV
DLISASSVEILEPVDGTQEATIPISSLPAIVCFSPSYDCPMQMIGNRHRCFGLVTQLDGV
ISSGSTVVMSHAYWSANFRSKPNNYKQYAPMYKYVEPFDRLKRLSRKQLKNYVRGITNQS
VNHGYLLGKPLLKTDEQDPEMIVLEEESLTPTDSNGVGKDKIAVTAKSVAGLPTASLSIN
RR
NT seq 909 nt   +upstreamnt  +downstreamnt
atgtctaacactacttttagaccttttactggttcctccaggaccgtggtcgagggagaa
caagccggcgcccaggatgatatgtcgttgttacagtcacttttttccgacaaatccagg
gaggagtttgctaaggagtgtaagttgggtatgtataccaatttatcctctaataaccgg
cttaattatatagatctagtccccaagaacactggtagtagagctctgaacttatttaag
tcagagtatgaaaaaggtcacattccctccagcggtgtgcttagtatacctagagtgctg
gtttttcttgtgaggacgacaacagtgactgaatctgggagtgtcaccattagattggtt
gacttgataagcgcttcgtcggttgagattttagaacctgtggatggtacgcaagaggct
actattcctatttctagtcttccggctatcgtttgtttttctcctagttatgactgtccc
atgcagatgatagggaatagacacagatgtttcggtttggtaactcaactggatggtgtc
atatcctcagggtctaccgtcgttatgagtcatgcgtattggtctgcgaactttcgtagt
aaacctaataactacaagcagtacgcacctatgtataagtatgtggaaccctttgacagg
ttgaaacgtttgagccgtaaacaattgaaaaattatgttaggggcataacgaatcaatct
gtaaatcatggttatctattgggtaaaccactactgaagactgacgagcaagatccagag
atgattgtgttagaggaggaatcactaacccctaccgacagcaacggagtcggcaaggat
aaaatcgccgtaaccgctaaatccgttgcggggcttccgacggcctcgttgtctatcaat
cgtagatag

DBGET integrated database retrieval system