KEGG   Viruses: 962675Help
Entry
962675            CDS       T40000                                 

Gene name
BSMVs3gp1
Definition
(RefSeq) Barley stripe mosaic virus; RNA-directed RNA polymerase
Taxonomy
TAX:12327 [GN:T40168]
  Lineage
Viruses; ssRNA viruses; Virgaviridae; Hordeivirus
Taxonomy
Organism
vg  Viruses (Barley stripe mosaic virus)
SSDB OrthologParalogGFIT
Motif
Pfam: RdRP_2 DUF5051
Motif
Other DBs
NCBI-GeneID: 962675
NCBI-ProteinID: NP_604481
RS: NC_003478
UniProt: Q80873
Position
NC_003478:89..2404
AA seq 771 aa AA seqDB search
MDVVKKFAVMSVTVVAGPVLTLSSPVVVTFGTSLIAVSLVKRLLQEQPRVIAHDHEHYPG
GSESSSSSCATAPILRNLSRDQCDSENIGCSSSACSPSEIVKVTRQVVEVERGLYRDKQQ
FGMDVVKKFAVMSVTVVAGPVLTLSSPVVVTFGTSLIAVSLVKRLLQEQPRVIAHDHEHY
PGGSESSSSSCATAPILRNLSRDQCDSENIGCSSSACSPSEIVKVTRQVVEVERGLYRDI
FQDNEIPSVMEEKLQKLLYSEGEKIRRRCQFEASTMHSRKVKVPEVGTIPDIQTWFDATF
PGNSVRFSDFDGYTVATEDINMDVQDCRLKFGKTFRPYEFKESLKPVLRTAMPEKRQGSL
IESVLAFRKRNLAAPRLQGALNEWHTIENVLKKALKVFFFEDLIDRTDHCTYESALRWWD
KQSVTARAQLVADQRRLCDVDFTTYNFMIKNDVKPKLDLTPQVEYAALQTVVYPDKIVNA
FFGPIIKEINERIIRALRPHVVFNSRMTADELNETVAFLTPHKYRALEIDFSKFDKSKTG
LHIKAVIGLYKLFGLDGLLKVLWEKSQYQTYVKDRNFGLEAYLLYQQKSGNCDTYGSNTW
SAALALLDCLPLEDAHFCVFGGDDSLILFDQGYIISDPCRQLAGTWNLECKVFDFKYPAF
CGKFLLCIDGKYQFVPDAAKFITKLGRTDVRDVEVLSEIYISINDNYKSYKDFKVLDALD
KALVDRYRSPYSAISALVSLCYHIFDFNKFKLLFNCEGKFVDKKLRKDFEW
NT seq 2316 nt NT seq  +upstreamnt  +downstreamnt
atggatgttgtgaagaaattcgccgtcatgtcagtgactgtagtagcaggtcccgtcctt
acgctttcatcacctgtggtggtgacgtttggaacaagcttaattgccgtatctttggtg
aaacggttgctacaggaacaaccccgtgtaattgctcacgatcacgaacattacccaggt
ggttctgagagcagttctagctcttgtgctaccgcgcctattttacgtaatctttcgcga
gatcagtgcgattcagagaatattggatgcagttctagcgcctgttctccgtctgaaatt
gtgaaagttacaaggcaggtagtggaagttgaacgtggtctttaccgggacaaacaacaa
ttcggcatggatgttgtgaagaaattcgccgtcatgtcagtgactgtagtagcaggtccc
gtccttacgctttcatcacctgtggtggtgacgtttggaacaagcttaattgccgtatct
ttggtgaaacggttgctacaggaacaaccccgtgtaattgctcacgatcacgaacattac
ccaggtggttctgagagcagttctagctcttgtgctaccgcgcctattttacgtaatctt
tcgcgagatcagtgcgattcagagaatattggatgcagttctagcgcctgttctccgtct
gaaattgtgaaagttacaaggcaggtagtggaagttgaacgtggtctttaccgggacatt
tttcaggacaacgaaatcccatcagtcatggaagagaaactgcagaaactcctttactct
gagggtgagaagattcgaagacgttgccaatttgaagcatcaacgatgcactcacgcaaa
gtaaaggttccggaggtaggtactatcccagatatccaaacttggttcgatgctacgttt
cctggtaactccgttaggttttctgatttcgacggttatactgttgctacggaggacatt
aacatggatgttcaggattgtagacttaagttcgggaagacttttcgaccttatgaattt
aaggaatcactgaaaccagtactgaggacagcaatgccagaaaagcgacagggtagtttg
attgaaagtgtgctggcctttcgtaaaagaaatttggctgcgcccagattacaaggggct
ttgaatgaatggcacacaattgagaatgtgctgaagaaggcgttaaaggtattcttcttt
gaagatttaattgatcgaacggatcattgcacttacgagtcagcgctcagatggtgggat
aaacaatcagtgacggctcgagcgcagctcgtggcggaccaacggaggttatgtgatgtt
gacttcacgacttataacttcatgataaaaaatgatgtaaaaccgaagttagatctaaca
cctcaagttgaatatgcagctttgcagactgttgtgtatcctgataagatagtcaatgct
ttctttggtccgatcataaaggagattaatgaacggatcatcagagcgcttagacctcat
gtggtctttaattctcgtatgactgctgatgaactgaatgaaacagttgcctttttgaca
cctcacaagtacagagccttagagattgacttttcaaaatttgataaatcaaagactggg
cttcatatcaaagctgtcattggactctataagctctttggtctagatggcctgttaaaa
gtactctgggaaaaatcgcaatatcagacttacgtgaaagatagaaacttcggtctcgag
gcatatctattatatcagcaaaagtcaggaaattgtgacacttacggttcgaacacctgg
tctgccgccttggcgttgttagattgtcttcctttggaagatgcacatttctgtgtattt
ggtggtgatgattcattgatattgtttgatcagggatacataatttccgacccatgccgg
caacttgccggtacttggaatcttgaatgtaaagtgttcgacttcaagtaccccgcattt
tgtggtaaatttctgctgtgcatagatggaaaatatcagtttgttccagatgcggcaaaa
tttatcacaaaattaggtagaactgatgtgagagatgtagaagttttgagtgagatttat
atctctatcaatgacaattacaaatcttacaaagactttaaggtgcttgatgctttggat
aaggctttagtggacagatatcgatccccttatagtgctatttctgctttggtttcttta
tgttatcatatctttgactttaataagtttaagttgctgtttaattgtgaagggaaattt
gtggataagaagctgagaaaggacttcgagtggtga

DBGET integrated database retrieval system