KEGG   Viruses: 963858Help
Entry
963858            CDS       T40000                                 

Gene name
RBDVs2gp1
Definition
(RefSeq) Raspberry bushy dwarf virus; movement protein
Taxonomy
TAX:12451 [GN:T40243]
  Lineage
Viruses; ssRNA viruses; ssRNA positive-strand viruses, no DNA stage; Idaeovirus
Taxonomy
Organism
vg  Viruses (Raspberry bushy dwarf virus)
SSDB OrthologParalogGFIT
Other DBs
NCBI-GeneID: 963858
NCBI-ProteinID: NP_620466
RS: NC_003740
UniProt: Q86563
Position
NC_003740:132..1208
AA seq 358 aa AA seqDB search
MFSRSSSTRSSLVGSRSGSIFGGGSVKKSSTVRGFSAGLERSRGLPSASAGENQISLPGL
RIPVKASSQPGNYYLKERGIDLPIVQQQKFLAADGKEMGECYLLDTSRTDLLDAAKAALN
ESNLLEFNKFKEFKKYKGKNNEFSLVEASVFDKLIRKDDSPIHLNRLLIAVLPAVGKGTP
GTARIKIRDARLDDGYGELFSSENRVDSGYIYCINVGYSVPKSEIDYKINIDFAGVPIKD
GKSPIWVKAAFSLAGGPPVFLDGTMSLGAEILPDSHKELLGTSALLLNEANSNRKSFSGD
DGELRRDYPYKRFEEISPLDSISQVDTASQDSVNEVNTENVQNGTGEVYLAPPSHSVY
NT seq 1077 nt NT seq  +upstreamnt  +downstreamnt
atgtttagcagaagttcctctactcgcagctcccttgtggggagcaggagtggctccatt
tttggagggggatctgttaagaagtctagtactgtgagggggttctctgccggtcttgaa
agatcgcgaggattaccttccgccagcgctggtgaaaaccagatctcgctgccggggctt
aggatcccagttaaggcttcttcacaaccgggaaattactaccttaaggagagaggtatt
gatttgccaattgtgcaacagcagaagtttctagccgctgacggcaaagaaatgggggag
tgttaccttttggacacttcccgaactgatctgttggacgctgccaaagcagcgttaaac
gagtctaatcttcttgaattcaacaaatttaaggaatttaagaagtataagggaaagaat
aatgaattctctttggttgaggcatcagtttttgataaactgatcaggaaggacgattct
cccatacaccttaacaggcttttaatagctgttttacctgccgtaggaaaaggaacacca
ggaaccgcacgaattaaaattcgtgacgcgcgcctggatgatggttatggtgagcttttt
agttctgaaaatcgtgtggactctggctacatttattgtataaatgtaggttattctgtt
cctaagtctgaaatcgattacaaaatcaatattgattttgccggggtacccatcaaagat
ggtaagtccccgatttgggtcaaggctgccttctctttagctggtggcccccctgtgttc
cttgatggaacaatgagcttgggtgctgagattttgcccgactctcataaagagctgttg
ggcacctctgctttgttgttgaatgaggcgaattctaataggaagtcgttctctggtgat
gacggagagcttagaagggattacccttataagcgttttgaggaaatttcacctttggat
tctataagtcaggtcgatacggccagtcaagactccgttaatgaggtgaacaccgaaaat
gttcaaaacggtactggtgaggtgtatttggcacctccttcacattccgtttattaa

DBGET integrated database retrieval system