KEGG   Viruses: 9925058Help
Entry
9925058           CDS       T40000                                 

Gene name
R436, MIMI_gp0467
Definition
(RefSeq) Acanthamoeba polyphaga mimivirus; putative serine/threonine-protein kinase
Taxonomy
TAX:212035
  Lineage
Viruses; dsDNA viruses; Mimiviridae; Mimivirus
Taxonomy
Organism
vg  Viruses (Acanthamoeba polyphaga mimivirus)
SSDB OrthologParalogGFIT
Motif
Pfam: Pkinase Pkinase_Tyr Pkinase_fungal Kdo Kinase-like APH CENP-B_N
Motif
Other DBs
NCBI-GeneID: 9925058
NCBI-ProteinID: YP_003986941
RS: NC_014649
UniProt: Q7T6Y1 A0A0G2YB36
Position
NC_014649:569223..570053
AA seq 276 aa AA seqDB search
MIFSNYSLDKLIQNRKSKRIFIGTDTITLQKVVIKIYDDKNKSKESILRDIHIPSILNHP
NIIKIKDYVEDLDSNKMYVIYPYIDNTISLRNLPVDKFDVTDLFKLYYIIDILIQVVDAI
SYMHDNNIVHRDIKPDNILLNDKVHLIDFDLSDQLDNPKFPVRKGTIGTPNFMAPEIWWK
INQVDYKKTDIYSLGITMYYLLNKRKLPYKAKKYSELEYQIANHKPKISNSGYPELDKLI
MKIIDKDPQNRPTISEIKQKLNHFKTIVDTRVNFNE
NT seq 831 nt NT seq  +upstreamnt  +downstreamnt
atgattttttcaaattacagtttggataaattgatacaaaatcgcaaaagtaagagaatt
tttattggaacagatacaattactctgcaaaaagtagtcataaaaatatatgatgataaa
aataaatcaaaagagtctattttaagagatattcatataccttcaattttgaatcatccc
aatataatcaaaattaaagattatgttgaagatttagattcaaacaaaatgtacgtaatt
tatccatacatcgataacactattagtttacgtaatttacccgttgataaattcgatgtc
actgatttatttaaattatactacattattgacatattgattcaggtggttgatgctata
agttatatgcatgacaacaatattgttcacagagatattaaaccagataatattttactt
aatgataaagttcatttaatagattttgatttgtctgaccaacttgacaacccaaaattt
cctgttagaaagggaactattggaactccaaattttatggctccagaaatatggtggaaa
ataaatcaagtagattacaagaaaactgatatttattctctgggaataaccatgtattat
ttgttaaacaagagaaaacttccttataaagcaaaaaaatattctgaattagaatatcaa
attgcaaatcacaaaccaaaaatatctaattccggatatccagaattagataaactcatc
atgaaaataattgacaaagaccctcaaaatcgtcctactatttctgaaattaaacaaaaa
ctaaaccattttaaaactatagttgacacacgagtcaatttcaatgagtag

DBGET integrated database retrieval system