KEGG   Vibrio gazogenes: BSQ33_01620Help
Entry
BSQ33_01620       CDS       T04933                                 

Definition
(GenBank) esterase
  KO
K14731  epsilon-lactone hydrolase [EC:3.1.1.83]
Organism
vga  Vibrio gazogenes
Pathway
vga00903  Limonene and pinene degradation
vga00930  Caprolactam degradation
vga01220  Degradation of aromatic compounds
Brite
KEGG Orthology (KO) [BR:vga00001]
 09100 Metabolism
  09109 Metabolism of terpenoids and polyketides
   00903 Limonene and pinene degradation
    BSQ33_01620
  09111 Xenobiotics biodegradation and metabolism
   00930 Caprolactam degradation
    BSQ33_01620
Enzymes [BR:vga01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.1  Carboxylic-ester hydrolases
    3.1.1.83  monoterpene epsilon-lactone hydrolase
     BSQ33_01620
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Abhydrolase_3 Say1_Mug180 Peptidase_S9 Thioesterase Hydrolase_4
Motif
Other DBs
NCBI-ProteinID: ASA54557
UniProt: A0A1Z2SBR0
Position
1:357715..358638
Genome map
AA seq 307 aa AA seqDB search
MLSQKAQETLNGWIAAAGPVVDKVLDKSEVSWQETRELYMSGLEALFPALEDVDYQTERM
GTVDSLVCVPQNLSEPQRIILYIHGGGYVHGGVAAYKALCGNLAQKLNAKVYIPDYRQAP
EHPFPTPIDDVYATYQSLLKQGYHPKDISFVGDSAGGAMVVTIMRKARDAGLPLPSSGVA
FSPWADLTHSGQSAVTRDGVDPICNVAFLNQLGRIFLGDELATHPDASPVFANVQGLSPI
LLQLGENEVMLSDALRLGTNLAEAKVRTSIEVWPGMFHVWHLFAGQQPEADQAIDSAVSF
IKNNQTS
NT seq 924 nt NT seq  +upstreamnt  +downstreamnt
atgttgtcccaaaaagcacaagagacattaaatggctggattgcagccgcaggcccggtt
gtcgataaagtattagataaatctgaagtatcttggcaagaaacgcgtgagctgtatatg
tctggtctggaagcattattccccgcccttgaagacgtagactatcagacagaacgcatg
ggaaccgttgattcgttagtttgtgtccctcagaatctgtcagagccacagcgcatcatc
ttatacattcacggtggcgggtatgttcacggtggcgtagcggcttataaagcactctgt
gggaatttagcccaaaaactcaatgccaaggtctatattccagactaccgacaagcaccg
gaacacccattcccgacgcctattgacgatgtctatgcaacttaccaaagcctgctaaaa
caaggttatcaccctaaagatatcagttttgtcggcgactcagccggtggcgcaatggtc
gtaacgattatgagaaaagcgcgcgacgcaggattaccactaccttcgtcaggggtcgct
ttctcaccatgggctgatttgactcatagtggtcagtctgccgttactcgcgatggtgtc
gatccgatctgtaacgttgcatttttaaatcaactcgggcgcatatttttaggcgatgaa
ctcgccactcaccccgatgcttcacctgtttttgcaaatgtacaggggttatcccccatc
ctattacagttgggtgaaaacgaagtcatgttgagtgatgcattacggttaggaacaaac
cttgccgaagcaaaagtacgtacatcgattgaagtatggccaggtatgttccatgtttgg
cacctgtttgccggacaacagcccgaagccgatcaggcaatcgatagtgctgtatcattt
attaaaaataatcagacaagctaa

DBGET integrated database retrieval system