KEGG   Vibrio gazogenes: BSQ33_05495Help
Entry
BSQ33_05495       CDS       T04933                                 

Definition
(GenBank) oxaloacetate decarboxylase subunit alpha
  KO
K01571  oxaloacetate decarboxylase (Na+ extruding) subunit alpha [EC:7.2.4.2]
Organism
vga  Vibrio gazogenes
Pathway
vga00620  Pyruvate metabolism
vga01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:vga00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00620 Pyruvate metabolism
    BSQ33_05495
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02000 Transporters [BR:vga02000]
    BSQ33_05495
Enzymes [BR:vga01000]
 7. Translocases
  7.2  Catalysing the translocation of inorganic cations
   7.2.4  Linked to decarboxylation
    7.2.4.2  oxaloacetate decarboxylase (Na+ extruding)
     BSQ33_05495
Transporters [BR:vga02000]
 Other transporters
  Primary active transporters [TC:3]
   BSQ33_05495
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: HMGL-like PYC_OADA Biotin_lipoyl Biotin_lipoyl_2 HlyD_3 HlyD_D23
Motif
Other DBs
NCBI-ProteinID: ASA55235
UniProt: A0A1Z2SDJ7
Position
1:complement(1206368..1208185)
Genome map
AA seq 605 aa AA seqDB search
MSKSLALTDVVLRDAHQSLFATRMRIEDMLPIASALDQVGYWSLETWGGATFDSCIRFLG
EDPWERLRTLKQAMPKTPMQMLLRGQNLLGYRHYADDVVEKFVERAHRNGMDVFRIFDAM
NDVRNFKKAVQSTIDVGAHAQGTLSYTTSPVHNIDMWVDLAKRLEDLGCHSLCIKDMSGL
LKPYEAETLIRRIKQSCDVPLALHCHATTGLSTATAIKAVEAGIDILDTAISSMSQTYGH
TPTETVVAMLENSERDTGLSLEQLAPIAAYFRDVRKKYAKWEGQLKGVDSRILIAQVPGG
MLTNMEGQLKDQGAADRIDEVLAEIPKVRHDLGYIPLVTPTSQIVGTQAVINVLMGERYK
SITKETAGVLKGEYGAAPAPVSAELQARVLEGQQPITCRPADLIESEMAILTDELTEKAK
AEGIALAESVVDDVLTYALFPQVGLKFLKNRNNPDAFEPRPTGEDATAVKAVPDAGSDGT
VSNNTVSNNKGVESYSVKVDGQVYAVEVGPQGQLTSVTSASNAAAQPTEPVSKGDAEVIT
APLAGTIFKVNALPGHPVNEGDVLIVLEAMKMETEVRAAKNGTVQDVLVKEGDSVHVGSP
LFSLA
NT seq 1818 nt NT seq  +upstreamnt  +downstreamnt
atgtctaaatcattagcacttactgatgtcgttcttcgagacgcacaccagtctttgttt
gcgacgcggatgcgtattgaagatatgttacccatcgcatcagcgcttgatcaggttggt
tattggtctttagaaacttggggaggcgcaacgtttgattcttgtattcgctttctggga
gaagacccatgggagcgactcagaacactgaagcaggcgatgccgaaaaccccgatgcag
atgttgttgcgtggtcagaatctattgggatatcgtcattacgcagatgatgttgtcgaa
aaattcgtggagcgagcacatcgaaatgggatggatgtctttcggatctttgacgcaatg
aatgatgtgcgtaacttcaagaaagcagttcaatcgacgatcgatgtcggcgctcatgca
caaggtacgctctcttacaccacaagtccggttcataacatcgatatgtgggttgatctg
gcgaagcgtctggaagatcttggctgccactctttatgtatcaaagacatgtcagggtta
ttgaaaccttatgaagctgaaacattaatccgtagaattaagcagtcctgtgatgtgccg
ttagcattgcattgtcatgcgaccacggggctatcgacagcaacagccatcaaagccgtt
gaagcgggaattgatattttagatacagcgatttcatcgatgagccagacatatggacac
acaccgacggaaacggttgttgccatgttggagaatagtgagcgagatactgggctttct
ctggaacagttagctcccattgcagcgtatttccgtgatgtccgcaaaaaatatgcgaaa
tgggaagggcagcttaaaggggtcgattctcgtattctgattgctcaggtgccaggtgga
atgctaaccaatatggaagggcagttaaaggatcaaggtgcggcggatcgtattgacgaa
gttttggctgaaattccgaaagttcgccatgatctcggttatatcccattggtgactccg
acatcacaaatcgtcgggactcaagcggtaattaacgtgttgatgggtgaacgatataag
agtattaccaaagaaaccgctggggttctgaaaggggagtatggtgctgcgcctgcccct
gtcagtgctgaacttcaggcgcgagtacttgaggggcagcagcccattacttgtcgcccg
gcggacttgattgaatctgaaatggcaatactcaccgatgagctgaccgagaaagctaaa
gctgaagggatcgctttggctgagtccgtcgtcgatgatgttctgacgtatgcgcttttc
ccgcaggttgggctcaagttcctcaaaaacagaaataaccctgacgcgttcgaacctcga
cctaccggtgaagatgcgacagcagtaaaagcagtacctgatgctggctctgacggaact
gtctccaacaacactgtttctaacaataaaggtgtcgaatcctatagtgtgaaagtcgat
ggtcaagtctatgcggttgaagtcggtccacaagggcagttaacgtctgtgacatcggcc
tcgaatgcagcagcacaaccgactgagcctgtctcaaaaggagatgcagaagtcatcacc
gcacctttggcgggaacgatttttaaagtgaatgctttgcccggtcatcccgtgaatgag
ggcgatgtgctgattgtactagaagcgatgaaaatggaaaccgaggttcgtgctgctaaa
aatggcactgtgcaggacgttttggtgaaagaaggtgactcggtgcatgtcggttcaccg
ctattcagtttggcataa

DBGET integrated database retrieval system