KEGG   Vibrio gazogenes: BSQ33_06485Help
Entry
BSQ33_06485       CDS       T04933                                 

Definition
(GenBank) diacylglycerol kinase
  KO
K00287  dihydrofolate reductase [EC:1.5.1.3]
Organism
vga  Vibrio gazogenes
Pathway
vga00670  One carbon pool by folate
vga00790  Folate biosynthesis
vga01100  Metabolic pathways
Module
vga_M00126  Tetrahydrofolate biosynthesis, GTP => THF
Brite
KEGG Orthology (KO) [BR:vga00001]
 09100 Metabolism
  09108 Metabolism of cofactors and vitamins
   00790 Folate biosynthesis
    BSQ33_06485
   00670 One carbon pool by folate
    BSQ33_06485
Enzymes [BR:vga01000]
 1. Oxidoreductases
  1.5  Acting on the CH-NH group of donors
   1.5.1  With NAD+ or NADP+ as acceptor
    1.5.1.3  dihydrofolate reductase
     BSQ33_06485
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: DHFR_1
Motif
Other DBs
NCBI-ProteinID: ASA55394
UniProt: A0A1Z2SDY8
Position
1:complement(1397662..1398150)
Genome map
AA seq 162 aa AA seqDB search
MIISMIAAMAKNRVIGKENQMPWHLPADFAWFKRCTLGKPIIMGRKTFESIGKALPGRQN
IVITRNSQFCATGVEVADSLENALALADQADEVMIIGGGSIYQSSLPMASRLYLTYIQAD
IDGDTCFPEFGIEWYETYREEYPQDEKNAYDMSFVILEQNQD
NT seq 489 nt NT seq  +upstreamnt  +downstreamnt
atgattatcagtatgattgcagcaatggcgaagaatcgggtgattggtaaagaaaatcag
atgccttggcatttacccgctgattttgcttggttcaaacgttgtacgttgggtaaacca
atcatcatggggagaaaaactttcgagtcgattggtaaggcgcttcccggacgacaaaac
atcgtcatcactcgcaattctcagttttgtgcaactggggttgaggtggcagattccctt
gaaaatgcattggcgttagctgatcaggctgatgaagtcatgattattggcgggggcagt
atttatcaatccagcttaccgatggcttcaagactgtatcttacctatattcaggctgat
attgatggggatacttgtttccctgaattcggtattgaatggtacgagacctatcgggaa
gagtatccacaagatgaaaagaatgcctatgacatgtcatttgtgatactggagcaaaat
caagattaa

DBGET integrated database retrieval system