KEGG   Vibrio gazogenes: BSQ33_07760Help
Entry
BSQ33_07760       CDS       T04933                                 

Definition
(GenBank) glutamate racemase
  KO
K01776  glutamate racemase [EC:5.1.1.3]
Organism
vga  Vibrio gazogenes
Pathway
vga00471  D-Glutamine and D-glutamate metabolism
vga01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:vga00001]
 09100 Metabolism
  09106 Metabolism of other amino acids
   00471 D-Glutamine and D-glutamate metabolism
    BSQ33_07760
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01011 Peptidoglycan biosynthesis and degradation proteins [BR:vga01011]
    BSQ33_07760
Enzymes [BR:vga01000]
 5. Isomerases
  5.1  Racemases and epimerases
   5.1.1  Acting on amino acids and derivatives
    5.1.1.3  glutamate racemase
     BSQ33_07760
Peptidoglycan biosynthesis and degradation proteins [BR:vga01011]
 Precursor biosynthesis
  Racemase
   BSQ33_07760
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Asp_Glu_race
Motif
Other DBs
NCBI-ProteinID: ASA55600
UniProt: A0A1Z2SEI5
Position
1:complement(1703964..1704785)
Genome map
AA seq 273 aa AA seqDB search
MSSQVSNILIFDSGVGGLSVYREIHQRLPDHNYFYLFDNEGYPYGELPQQELLHRVEAFV
TSIVKKMAIDIVVIACNTASTIVLPSLRKRLDIPVVGVVPAIKPACNLAQQCVGLIATPA
TIKRPYTHELIRDFSSDKDICLLGSTALVDMAERKLRGVTVNMFELASILQPIQGKIDVA
VLGCTHFPLLRDEIQQVLGSKVILVDSGNAIARRVESLISETMCRHTPKTPRVFASTSPY
DSEALTQVLSDWGFNQIENYPIQGFSDHSQPEL
NT seq 822 nt NT seq  +upstreamnt  +downstreamnt
gtgtcctcacaagtttctaatatcctaatctttgactccggtgtcggtggcctctcggtt
tatcgggaaattcatcagcgactacccgatcataactacttctatctgttcgataatgaa
ggctatccatatggagagctaccacaacaggaattactccaccgggttgaagccttcgtt
acatctatcgttaagaaaatggcgattgatattgttgtgattgcttgtaataccgcgagc
acgattgttttgccttccttacgaaagcgcttggatatccctgtcgtcggagtggtgcct
gcgattaagcctgcgtgtaatttggctcagcaatgtgtcggccttattgcgactccagcg
accatcaagcggccttatacgcatgagctgattcgggacttctcatctgataaagatatc
tgtctgcttgggtcaacagcgttggtcgatatggctgagcgtaaattacgtggcgttaca
gtgaacatgtttgaactggcaagcattcttcaaccgattcaggggaaaatcgatgttgcg
gtactcggctgcacacatttcccgctattgagagatgagattcagcaggtattaggaagc
aaggtcattctggtggattctggcaatgcgattgcccgaagggtggagagcttgatttct
gaaacaatgtgtagacataccccaaaaacacctcgggtttttgccagcacttcgccatat
gatagcgaagcactgacacaagttttatccgattggggatttaatcaaattgagaactat
ccgattcagggtttttcggatcattcgcaacccgaactttaa

DBGET integrated database retrieval system