KEGG   Vibrio gazogenes: BSQ33_08270Help
Entry
BSQ33_08270       CDS       T04933                                 

Definition
(GenBank) oxygen-independent coproporphyrinogen III oxidase
  KO
K02495  oxygen-independent coproporphyrinogen III oxidase [EC:1.3.98.3]
Organism
vga  Vibrio gazogenes
Pathway
vga00860  Porphyrin and chlorophyll metabolism
vga01100  Metabolic pathways
vga01110  Biosynthesis of secondary metabolites
Module
vga_M00121  Heme biosynthesis, plants and bacteria, glutamate => heme
Brite
KEGG Orthology (KO) [BR:vga00001]
 09100 Metabolism
  09108 Metabolism of cofactors and vitamins
   00860 Porphyrin and chlorophyll metabolism
    BSQ33_08270
Enzymes [BR:vga01000]
 1. Oxidoreductases
  1.3  Acting on the CH-CH group of donors
   1.3.98  With other, known, physiological acceptors
    1.3.98.3  coproporphyrinogen dehydrogenase
     BSQ33_08270
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Radical_SAM HemN_C
Motif
Other DBs
NCBI-ProteinID: ASA55698
UniProt: A0A1Z2SEX7
Position
1:complement(1819097..1820482)
Genome map
AA seq 461 aa AA seqDB search
MFQQVSRQQVVWDQAMLDKYNYSGPRYTSYPTAVEFHEAFTIADFDMACAQYPERPLSLY
VHIPFCHKLCYYCGCNKVVTRHSHKADEYLDMLELEIRQRASLLAGRRVVQLHFGGGTPT
FLTAPQITRLMTLIRQEFDFEPEAEISIEVDPREIELDILDHLYQEGFNRLSIGVQDFNK
EVQLLINRIQDETFIFALAERARELGFRSTNLDLIYGLPKQTPNSFARTLNRVLEIKPGR
LSIFNYAHMPQLFAAQRKIKEDFLPTAQEKMDILQMTIGTLTDAGYQFIGMDHFALPEDD
LAIAQREGCLHRNFQGYTTYGDCDLIGFGVSAISMVGDAYAQNQKELKKYYQQVEHQRHA
LWKGVALDKDDLARRDVIKQLMCNFALDKAQIERTHQLDFDRYFQSDLALLEHFITDGLV
LVSDKQLTVTPKGRLLIRNICMCFDRYLRERARQQQFSRVI
NT seq 1386 nt NT seq  +upstreamnt  +downstreamnt
atgtttcagcaggtatctcgtcagcaggttgtctgggatcaggcaatgttggataaatat
aattactccggacctcgctatacctcctatccgacagccgtcgaattccatgaagcattt
acgattgcggactttgatatggcttgtgcccagtatccggagcgtccgctttctctctat
gtccatatccctttttgccataagctttgttactactgtggttgtaataaggtcgtcacg
cgtcattctcataaagcggatgagtatttggatatgctggagcttgagattcgtcagcgt
gcctcgttgttagctggtcgtcgtgtggttcagcttcatttcggtggtggtacaccgaca
tttctgaccgctccccaaatcacgcgtttgatgacactgatcaggcaggagtttgatttt
gagcctgaggctgaaatcagtattgaagtcgatccacgcgagatagaactggatatcttg
gaccatctttatcaagaaggttttaaccgcttaagtatcggggttcaggatttcaataaa
gaagttcagctactcatcaatcggattcaggatgagacgttcatcttcgctttggcagaa
cgtgcccgggaattggggttccgttcgaccaaccttgacctgatttatggtttgcctaag
caaacaccgaattcatttgcacggacgttaaaccgggtgctggaaataaaaccgggccgg
ttatctattttcaattacgcgcatatgccgcaattgtttgctgcacagcggaagattaaa
gaagattttctgccgacagcgcaagagaaaatggacattttgcagatgaccattggtacg
ttgacggatgcgggctatcagtttatcggcatggatcattttgcattgcctgaagatgat
cttgcgattgcgcagagagaaggttgtctccatcgtaattttcagggatataccacgtat
ggtgactgcgatctgattggttttggggtgtcagcaatctcgatggtcggtgatgcttat
gcccagaatcagaaagaattgaagaagtactatcagcaagtggaacatcagcgtcatgca
ttatggaaaggggtcgcgttggataaagatgatctggcccgccgggacgtaattaagcaa
ctgatgtgtaactttgctctcgataaagctcagatcgagcgcactcatcagctcgatttt
gatcgctatttccagtcggacttagcactactggaacatttcattactgatggattggtt
ttagtcagtgataaacagttaacggtaacgcctaaaggtcgtctgttgattcgtaatatc
tgtatgtgctttgaccgttatctgcgagaaagagcaagacagcagcagttttcccgggtg
atatga

DBGET integrated database retrieval system