KEGG   Vibrio gazogenes: BSQ33_10555Help
Entry
BSQ33_10555       CDS       T04933                                 

Definition
(GenBank) adenylosuccinate synthase
  KO
K01939  adenylosuccinate synthase [EC:6.3.4.4]
Organism
vga  Vibrio gazogenes
Pathway
vga00230  Purine metabolism
vga00250  Alanine, aspartate and glutamate metabolism
vga01100  Metabolic pathways
Module
vga_M00049  Adenine ribonucleotide biosynthesis, IMP => ADP,ATP
Brite
KEGG Orthology (KO) [BR:vga00001]
 09100 Metabolism
  09104 Nucleotide metabolism
   00230 Purine metabolism
    BSQ33_10555
  09105 Amino acid metabolism
   00250 Alanine, aspartate and glutamate metabolism
    BSQ33_10555
Enzymes [BR:vga01000]
 6. Ligases
  6.3  Forming carbon-nitrogen bonds
   6.3.4  Other carbon-nitrogen ligases
    6.3.4.4  adenylosuccinate synthase
     BSQ33_10555
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Adenylsucc_synt
Motif
Other DBs
NCBI-ProteinID: ASA56093
UniProt: A0A1Z2SFY5
Position
1:2329693..2330994
Genome map
AA seq 433 aa AA seqDB search
MGNNVVVLGTQWGDEGKGKIVDLLTEDAKYVVRYQGGHNAGHTLVIDGEKTVLHLIPSGI
LREHVKCIIGNGVVLSPDALLKEMEALEARGIPVRQRLSISEACPLILPYHIALDQARES
ARGTKAIGTTGRGIGPAYEDKVARRGLRVGDLFDRTTFAAKLQEVMAYHNFQLVNFYKAE
PVSYDEVLEQAMGYADLLTSMVIDVTDELDTARKRGDKIMFEGAQGTLLDIDHGTYPYVT
SSNTTAGGVAAGSGFGPRHLGYILGIAKAYCTRVGAGPFPTELNDETGDYLGTKGQEFGA
TTGRKRRCGWFDAVAMRRAIQINSITGFCMTKLDVLDGLKEIKICTGYQMKDGSTAEVSP
MAADAYDHVTPIYETMPGWSESTFGVKKLEDLPQAALNYVQRIEELTGVPVDIISTGPDR
NETIIKVHPFSVA
NT seq 1302 nt NT seq  +upstreamnt  +downstreamnt
atgggaaataacgttgtcgtactaggcacccaatggggtgatgaaggtaaagggaaaatt
gttgatctgcttactgaagatgcaaagtatgttgtccgttatcagggcggtcataatgca
ggtcatactctggtcattgatggtgagaaaaccgttcttcacttgattccatccggtatt
ctccgcgaacacgtaaaatgcattatcggaaatggcgttgtactttctccggatgcactt
ttaaaagaaatggaagcgcttgaagctcgaggcattcctgttcgccaacgtctttctatt
tctgaagcttgtccgctcattttgccttaccatattgcactggatcaggctcgcgaatca
gctcgtggtacaaaagctatcggcacaaccggacgtggtatcggtccagcttatgaagat
aaagttgcgcgccgtggtttacgtgtcggagacttgtttgatcgcaccacttttgcagcc
aaactacaggaagtcatggcgtatcataacttccaactggtcaacttctataaagctgaa
cctgtgagttacgatgaagttctagaacaggccatgggttatgcagatttgctcacctca
atggttattgatgtgactgatgaactggatacggctcgtaagcgcggtgacaaaattatg
ttcgaaggcgctcagggaacactgttggatattgatcacgggacttatccgtatgtgacc
tcatctaatacgactgcaggcggtgttgctgccggttctggcttcggtcctcgtcatctt
gggtatattcttggtattgccaaagcgtattgtactcgcgttggtgccggtcctttcccg
actgagttgaatgacgaaacgggtgattatctgggaactaaagggcaggaatttggagca
acaaccggacgtaagcgccgttgtggctggtttgatgccgttgcgatgcgccgtgcgatt
caaatcaactcgattactggtttctgtatgacgaagcttgatgtcttagatggtttgaaa
gaaatcaaaatctgtaccggttaccaaatgaaagacggttctaccgctgaagtttctcca
atggctgctgatgcttacgatcatgtaaccccgatttatgaaacaatgccaggttggtct
gagagtacgtttggtgttaaaaagcttgaagatttgcctcaggccgcattgaactatgtt
caacgcatcgaagaattaaccggtgtacctgtcgatattatttcaactggcccggaccgg
aatgaaacgattatcaaagttcatccgttcagtgttgcgtaa

DBGET integrated database retrieval system