KEGG   Vibrio gazogenes: BSQ33_13390Help
Entry
BSQ33_13390       CDS       T04933                                 

Definition
(GenBank) tRNA (N6-threonylcarbamoyladenosine(37)-N6)-methyltransferase TrmO
  KO
K22900  tRNA (adenine37-N6)-methyltransferase [EC:2.1.1.-]
Organism
vga  Vibrio gazogenes
Brite
KEGG Orthology (KO) [BR:vga00001]
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03016 Transfer RNA biogenesis [BR:vga03016]
    BSQ33_13390
Enzymes [BR:vga01000]
 2. Transferases
  2.1  Transferring one-carbon groups
   2.1.1  Methyltransferases
    2.1.1.-  
     BSQ33_13390
Transfer RNA biogenesis [BR:vga03016]
 Eukaryotic type
  tRNA modification factors
   Methyltransferases
    BSQ33_13390
 Prokaryotic type
    BSQ33_13390
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: TrmO TrmO_C
Motif
Other DBs
NCBI-ProteinID: ASA56587
UniProt: A0A1Z2SHL8
Position
1:complement(2918486..2919193)
Genome map
AA seq 235 aa AA seqDB search
MTPNDHTLTPIGIIHSPYKEKFAVPRQPRLVPAATAQIQLIGDANCPDSVRGIEQFSHLW
LLFLFDQNLSAGWKPTVRPPRLGGNERIGVFASRSTFRPNGIGMSAVELHNIRQEGNQTW
LDIGSVDLVDGTPIIDIKPYLPYADRIEHAHGGYADSEPTSTDVRFSDAARQSLAAHPRV
NEIEAVITQVLAQDPRPAYKKGKPDEKEYAVNLFDLNVKFNVSQSIITVTAIERF
NT seq 708 nt NT seq  +upstreamnt  +downstreamnt
atgacaccaaatgatcatacgctcacaccgattggcatcattcatagtccttacaaagag
aaatttgcggtaccacgacaaccccggctggtcccggcggctaccgctcaaattcaactg
ataggtgacgcaaactgtccggattcagtccggggtatcgaacaattcagccatctgtgg
ctcttgttcttattcgatcagaatctcagtgccggctggaaaccaaccgtccgtccaccc
cgacttggcggtaacgaacgtatcggtgtctttgcatcccgctcaacctttcgccccaac
ggcattggtatgtcagcggttgaattacataatatccgtcaggaaggcaaccaaacatgg
ctcgatatcggcagcgttgatttagtcgatgggacgccgattatcgatattaaaccttac
ctcccttatgctgaccgaattgaacatgcccacggcggatatgctgacagcgaaccgaca
tcgacagatgtccgcttcagtgatgctgcgcgccaatcacttgccgcccatcctcgtgtc
aatgaaattgaagccgtcattactcaggttttagcgcaggatcctcgtccggcttataaa
aaaggcaaacctgatgagaaagagtatgcggtgaatttgttcgatctcaacgtcaaattc
aatgtcagtcagtcgatcatcacggttaccgcaatagaacgcttttga

DBGET integrated database retrieval system