KEGG   Vibrio gazogenes: BSQ33_13480Help
Entry
BSQ33_13480       CDS       T04933                                 

Definition
(GenBank) 23S rRNA (cytidine(2498)-2'-O)-methyltransferase RlmM
  KO
K06968  23S rRNA (cytidine2498-2'-O)-methyltransferase [EC:2.1.1.186]
Organism
vga  Vibrio gazogenes
Brite
KEGG Orthology (KO) [BR:vga00001]
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03009 Ribosome biogenesis [BR:vga03009]
    BSQ33_13480
Enzymes [BR:vga01000]
 2. Transferases
  2.1  Transferring one-carbon groups
   2.1.1  Methyltransferases
    2.1.1.186  23S rRNA (cytidine2498-2'-O)-methyltransferase
     BSQ33_13480
Ribosome biogenesis [BR:vga03009]
 Prokaryotic type
  rRNA modification factors
   23S rRNA modification factors
    BSQ33_13480
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: RlmM_FDX FtsJ
Motif
Other DBs
NCBI-ProteinID: ASA56603
UniProt: A0A1Z2SHE0
Position
1:2934471..2935562
Genome map
AA seq 363 aa AA seqDB search
MKQVMLYCRAGFEKECAGEIQDKASRIEVFGFPRLKYQTGYVLFECYQDGDADKLIREID
FQSLIFARQIFAVSATCESLPKDDRISPILQSLGDIEGLPRCGDLRVETPDTNEAKELLK
FCRKFTVPLRQALRGKGILFGKDEPKKPVLHVCFVAPGHCYIGYSYTNNNSSFFMGIPRL
KFPADAPSRSTLKLEEAFHVFIPRSEWDERLASGMWAVDLGACPGGWTYQLVQRSMFVHA
VDNGMMADSLMDTGQVKHHMEDGFKFEPPRKNVTWLVCDMVEKPARVAQLMGEWLIRGWA
KEALFNLKLPMKGRYDEVLQDIDNLKHFLKDNHVNFRLQAKHLYHDREEITVHVRSLSNI
SPH
NT seq 1092 nt NT seq  +upstreamnt  +downstreamnt
gtgaagcaggtcatgctctattgccgtgccggttttgagaaagaatgtgccggagaaatt
caggacaaagcaagccgaatcgaagtattcggctttccgcgtttgaagtatcaaaccgga
tatgtgctgtttgaatgttatcaggatggcgatgccgataagctgattcgagagatcgac
tttcaaagtctgatttttgcgcgtcagatttttgcagtcagtgccacgtgtgaatcttta
ccgaaagacgatcgaatctcgcccattcttcagtcactgggggacatcgaagggttacct
cgctgtggtgatctgcgggtcgaaacccccgataccaatgaagcgaaagagttgctgaaa
ttttgccgtaaattcacggtaccgctgcgccaagcattgcgggggaaaggcattctgttt
ggcaaagatgagccgaagaaaccagtgctacatgtctgttttgtcgcgcccggtcattgc
tacatcggttattcttataccaataataactcatcgttttttatgggaatcccacgtctg
aaatttccagcggatgcgccgagtcgttcaacgctgaaactggaagaagcatttcatgtg
tttattccccgctcggaatgggatgaacgcttagcttcagggatgtgggcggttgatctg
ggcgcttgtcccggtgggtggacctatcagttggtgcagcgttcgatgtttgttcatgcg
gtcgataatggcatgatggcggatagtctgatggataccggtcaggttaaacatcatatg
gaagatggcttcaaatttgagccgccacgtaaaaatgtcacttggttagtgtgtgatatg
gtcgagaagccggctcgcgtcgcacaactgatgggagaatggctgatccgcggctgggcg
aaagaagcgctgtttaatctgaaattgccgatgaagggacgttatgacgaagtgttacag
gatatcgataacctgaagcattttctgaaggataaccacgtcaatttccggttacaggcc
aaacatctttatcatgaccgggaagaaattaccgtgcatgtccggagcttatctaatatt
tctcctcactaa

DBGET integrated database retrieval system