KEGG   Vibrio gazogenes: BSQ33_13490Help
Entry
BSQ33_13490       CDS       T04933                                 

Definition
(GenBank) LOG family protein
  KO
K06966  pyrimidine/purine-5'-nucleotide nucleosidase [EC:3.2.2.10 3.2.2.-]
Organism
vga  Vibrio gazogenes
Pathway
vga00230  Purine metabolism
vga00240  Pyrimidine metabolism
vga01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:vga00001]
 09100 Metabolism
  09104 Nucleotide metabolism
   00230 Purine metabolism
    BSQ33_13490
   00240 Pyrimidine metabolism
    BSQ33_13490
Enzymes [BR:vga01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.2  Hydrolysing N-glycosyl compounds
    3.2.2.10  pyrimidine-5'-nucleotide nucleosidase
     BSQ33_13490
    3.2.2.-  
     BSQ33_13490
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: DUF3412 DUF4478 Lysine_decarbox LDcluster4 Glycos_transf_2 Ribonuc_L-PSP
Motif
Other DBs
NCBI-ProteinID: ASA56605
UniProt: A0A1Z2SHJ4
Position
1:complement(2936472..2937836)
Genome map
AA seq 454 aa AA seqDB search
MITHISPTGSMDLLSQIEVERLKKTASSGDLYQLYRNCTLAVLNSGSHTDSSKELLDKYQ
NFDVNVLRRERGIKLELIEPPEHAFVDGEIIKGIQEHLCSVLRDIVYVNMHVADSKRYHQ
VDSVYNTNLVFDILRNARTLVPGLTPNLVVCWGGHSINPVEYQYTREVGNELGLRELNIC
TGCGPGAMEGPMKGAAIGHAKQRYKNARYIGLTEPSIIAAEPPNPIVNELIIMPDIEKRL
EAFVRMAHGIVIFPGGPGTAEELLYILGIMMHPDNAEQPFPIILTGPKGSEDYFNSIDQF
ISETLGEAARKHYQIIIDDPARVARKMNESMPVVRQFRKAHGDAYSFNWSLKIDPEFQLP
FVPTHHAMANLDLHMNQKPEVLAANLRKAFSGIVAGNVKAEGIREIEQHGPFIIDGEPAI
MQKMDKLLKDFVKQNRMKLPGGQAYEPCYKIANK
NT seq 1365 nt NT seq  +upstreamnt  +downstreamnt
atgattactcatatcagcccaaccggaagtatggacctgctctcgcagattgaagttgaa
cgcctgaaaaaaaccgcatccagcggggatctataccaactttacagaaactgtacactg
gctgttttgaattctggcagccacaccgacagctctaaagagttgctggataaatatcag
aactttgatgtcaacgtcctcagacgcgaacgggggataaaactagaacttattgaacca
cctgaacatgccttcgtggatggcgaaatcatcaaagggattcaagaacacctttgttcc
gtgttacgggacattgtttatgtcaacatgcatgtcgcagacagcaaacgctaccatcag
gtcgattccgtctataacaccaatttggtattcgatatcttacgtaacgcccggactctt
gtccccggactgacgccaaacctagtggtctgctggggcggacattcaatcaatccggtt
gaataccaatatacccgcgaagtcggcaatgaactcggactacgcgagctcaatatctgt
actggctgtggtccgggagcgatggaaggtccgatgaaaggcgcagcaatcggccatgca
aaacagcgttataaaaatgcacgctatattggcctgaccgagccttcaatcatcgcagca
gagccaccaaacccgatcgtgaatgagctgatcatcatgccagacatcgagaagcgtctg
gaagcatttgtccgcatggcgcacggtattgtgattttccccggcggccccggtacggct
gaagaactgttatatatccttggcatcatgatgcatccggataatgccgaacaaccattc
ccgattattctgactggcccgaaaggtagtgaagactatttcaattcgattgatcaattt
attagtgaaacgttgggagaagcagctcgtaaacactatcagattatcattgatgatccg
gcgcgagtcgcgcgcaaaatgaatgagtcaatgcccgttgtccgccaattcagaaaagcg
catggtgatgcgtacagtttcaactggtcactcaaaatcgatccagagtttcagttacca
tttgtgccgactcatcatgcaatggcgaaccttgatctgcatatgaaccagaaacccgaa
gtacttgccgcaaatctacgtaaggcattttcaggcattgtagcagggaacgtcaaagcg
gaaggtattcgggaaatcgaacaacatgggcctttcatcatcgatggggagccggcaatc
atgcagaaaatggacaagctcttgaaagacttcgtcaaacaaaaccgcatgaaactgccc
ggcggacaggcttatgagccctgctataaaattgccaacaagtag

DBGET integrated database retrieval system