KEGG   Vibrio gazogenes: BSQ33_13575Help
Entry
BSQ33_13575       CDS       T04933                                 

Definition
(GenBank) hypothetical protein
Organism
vga  Vibrio gazogenes
SSDB OrthologParalogGene clusterGFIT
Other DBs
NCBI-ProteinID: ASA56616
UniProt: A0A1Z2SHG1
Position
1:complement(2955079..2955411)
Genome map
AA seq 110 aa AA seqDB search
MKTATIWGIVGLALTLAGCASNTKEDNYREASFELCNTDVKVYSLDNAGRVRIVCADGSK
FALKSEDTLEVMRGINIDYCDGEGLGKFTESENYYLFKCKSGTTLSISKD
NT seq 333 nt NT seq  +upstreamnt  +downstreamnt
atgaaaactgccactatctggggcattgtcggactcgcgctcacactcgcaggttgtgct
tcaaataccaaagaagataactaccgtgaagcgtcttttgaactttgtaataccgacgtg
aaagtctactcgctggataatgcagggcgcgttcgcatcgtctgtgccgacggctctaaa
tttgcgctcaaatcagaagatacactcgaagtcatgcgcgggatcaatattgattactgt
gatggcgaaggattaggcaaatttactgaaagtgaaaattactacttatttaagtgtaag
tcaggtacgacactgagcatctctaaagattaa

DBGET integrated database retrieval system