KEGG   Vibrio gazogenes: BSQ33_13655Help
Entry
BSQ33_13655       CDS       T04933                                 

Definition
(GenBank) magnesium/cobalt efflux protein
  KO
K06189  magnesium and cobalt transporter
Organism
vga  Vibrio gazogenes
Brite
KEGG Orthology (KO) [BR:vga00001]
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02000 Transporters [BR:vga02000]
    BSQ33_13655
Transporters [BR:vga02000]
 Other transporters
  Others
   BSQ33_13655
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: CorC_HlyC CBS YscJ_FliF_C
Motif
Other DBs
NCBI-ProteinID: ASA56630
UniProt: A0A1Z2SHG5
Position
1:complement(2972888..2973763)
Genome map
AA seq 291 aa AA seqDB search
MNEDNSQNSEGPSKKSFFGRLGQLFQGDPKDRQELVEVIRDSEINDLIDHDTKDMLEGVI
QISEMRVRDIMIPRSQMVTIDRDASLDKLITLITDAQHSRYPIISEDKDHVDGILLAKDL
LKYLGSTCTPFHIDEVIRPAVVVPESKRVDRLLKEFREERYHMAIVVDEFGGVSGLVTIE
DILEEIVGDIEDETDDEEQQDIRKLSKHTFSINALTTIEDFNQTFGTNFSDEEVDTVGGL
VMTAFGHLPERGEVVQLSDYQFKVTSADNRRVVQLQVTIPDVETVSEEFQE
NT seq 876 nt NT seq  +upstreamnt  +downstreamnt
atgaacgaagacaattcgcagaattctgaaggtccgagtaagaagtccttttttggacgt
ttaggtcagctttttcagggcgaccccaaagatcgacaggaattggtagaagttatccga
gattcggaaatcaacgacctgatcgatcacgatacgaaagatatgttggaaggggtcatt
caaatttctgaaatgcgagttcgggatattatgataccccgctctcagatggtgacgatt
gaccgagatgcatctctcgacaaactcatcactctcatcacagatgcccaacactcacgg
tatcccatcatcagtgaagataaagaccatgttgatggtatcttgctggcaaaagatcta
ctcaaatatctcggttcaacatgtacaccatttcatattgatgaagttatccgtcctgcg
gtggtcgttcccgaaagtaagcgcgtagatcggttgttgaaagagttccgggaagaacgc
taccacatggcgattgttgtcgatgaatttggcggagtgtccgggctggtgacaatcgag
gatatactggaagaaatcgtcggagatatcgaagatgagaccgatgatgaagaacaacag
gatatccgaaaactaagcaaacataccttttccatcaatgctctgacgacgattgaagac
tttaatcagacattcggcaccaacttcagtgatgaagaagtggataccgttggtgggctg
gtgatgacagcattcggtcatctccctgaacggggtgaagtggttcaattgtctgactat
cagtttaaagtgaccagtgcagataatcggcgcgttgttcaactacaagtgacaattcct
gacgttgaaaccgtttcagaagagttccaagaatag

DBGET integrated database retrieval system