KEGG   Vibrio gazogenes: BSQ33_13695Help
Entry
BSQ33_13695       CDS       T04933                                 

Definition
(GenBank) cysteine synthase A
  KO
K01738  cysteine synthase [EC:2.5.1.47]
Organism
vga  Vibrio gazogenes
Pathway
vga00270  Cysteine and methionine metabolism
vga00920  Sulfur metabolism
vga01100  Metabolic pathways
vga01110  Biosynthesis of secondary metabolites
vga01120  Microbial metabolism in diverse environments
vga01130  Biosynthesis of antibiotics
vga01200  Carbon metabolism
vga01230  Biosynthesis of amino acids
Module
vga_M00021  Cysteine biosynthesis, serine => cysteine
Brite
KEGG Orthology (KO) [BR:vga00001]
 09100 Metabolism
  09102 Energy metabolism
   00920 Sulfur metabolism
    BSQ33_13695
  09105 Amino acid metabolism
   00270 Cysteine and methionine metabolism
    BSQ33_13695
Enzymes [BR:vga01000]
 2. Transferases
  2.5  Transferring alkyl or aryl groups, other than methyl groups
   2.5.1  Transferring alkyl or aryl groups, other than methyl groups (only sub-subclass identified to date)
    2.5.1.47  cysteine synthase
     BSQ33_13695
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: PALP DFP
Motif
Other DBs
NCBI-ProteinID: ASA56637
UniProt: A0A1Z2SHR6
Position
1:complement(2981390..2982358)
Genome map
AA seq 322 aa AA seqDB search
MSKIFEDNSLTIGNTPLVRLNKVSQGNVLAKVEARNPSFSVKCRIGANMIWEAEKSGKLK
PGIELVEPTSGNTGIALAFVAAARGYKLTLTMPESMSLERRKLLKALGANLELTEAAKGM
KGAINKAEEIVASNPDKYLLLQQFDNPANPEIHEKTTGPEIWDATDGEVDVFVAGVGTGG
TLTGTSRYLKGEKGKAIISVAVEPEESPVITQALAGEEIKPAPHKIQGIGAGFIPGNLDL
SLIDRVERVTSEDAIDMARRLMEEEGILAGISSGAAVVAANRLAERPEFKDKTIVVILPS
SGERYLSTALFAGIFTEKENQQ
NT seq 969 nt NT seq  +upstreamnt  +downstreamnt
atgagtaagattttcgaagacaactccctgaccatcggtaacaccccactcgtccgtctg
aacaaagtgagtcaaggtaacgtactcgctaaggtagaagctcgtaacccaagtttcagc
gtgaagtgtcgtatcggtgccaacatgatttgggaagctgaaaaatccggcaaactcaaa
ccgggtattgaacttgttgaaccaaccagtggtaataccggtattgcactcgcgtttgtc
gctgctgcccgtggctacaagctgaccctgacaatgcctgagtcaatgagtttagagcgc
cgtaaactgctcaaagcgctgggagctaatctcgagttgacagaggcagcaaaagggatg
aaaggtgcaatcaacaaagcagaagagattgttgccagtaaccctgacaaatatttgcta
ctacaacaatttgataatccggcaaacccggaaattcatgaaaaaaccacaggtcctgaa
atctgggacgcaactgacggtgaagtagacgtattcgtcgcaggtgtcggaactggtggt
acattgacaggaaccagccgctatctcaaaggagagaaaggcaaagcgattatctctgtt
gcagttgaaccagaagaatcacctgtcataactcaggccctagctggcgaagaaatcaaa
ccggcgccgcacaaaattcaggggatcggtgctggttttatcccgggtaatctcgattta
tctctcatcgaccgtgttgaacgcgtgacgtctgaagatgcaattgacatggcccgtcgc
ctgatggaagaggaaggaattctcgcgggaatctcctctggtgcagccgttgtagctgca
aatcgtctggctgaacgccctgaatttaaagataaaacaatcgtcgtgattctgccgagc
tccggtgagcgttacctcagcactgcactatttgccggtatatttaccgagaaagagaac
caacaataa

DBGET integrated database retrieval system