KEGG   Vibrio gazogenes: BSQ33_13745Help
Entry
BSQ33_13745       CDS       T04933                                 

Definition
(GenBank) transcriptional regulator
Organism
vga  Vibrio gazogenes
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: P-II
Motif
Other DBs
NCBI-ProteinID: ASA56647
UniProt: A0A1Z2SHS5
Position
1:2991913..2992263
Genome map
AA seq 116 aa AA seqDB search
MRFKLIVAFVEDSKTDKVLDAARQAGATGATVINNARGEGLNQKTTFFGLTLEVQKDMVL
FVVEEHLSRQILETINEVGEFETESGQGIAFQIDIEDVVGISHQVEKLTKYVEDEL
NT seq 351 nt NT seq  +upstreamnt  +downstreamnt
atgcgctttaaattaatcgttgcctttgttgaagatagcaaaacagacaaagtattagat
gccgccagacaagcaggagcgacaggtgcgactgtgatcaataatgccagaggtgaagga
ctcaatcagaaaaccaccttctttggtctgacattggaggtacagaaggatatggtgctc
tttgtcgttgaagagcatttgtctcgtcaaattctggaaaccattaacgaagtcggagag
tttgaaacggagtcggggcagggaatcgcctttcaaattgatattgaagatgtcgttggc
atctctcatcaggttgaaaagttaaccaaatacgttgaggacgaattatga

DBGET integrated database retrieval system